Transcription Factor

						

			
Accessions: ZNF449 (HT-SELEX2 May2017)

			
Names: ENSG00000173275, ZNF449
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 211
Pfam Domains:      6-26 Zinc-finger double domain
    15-36 C2H2-type zinc finger
    16-38 C2H2-type zinc finger
    16-38 Zinc finger, C2H2 type
    32-54 Zinc-finger double domain
    43-66 C2H2-type zinc finger
    44-66 C2H2-type zinc finger
    44-66 Zinc finger, C2H2 type
    58-83 Zinc-finger double domain
    71-95 C2H2-type zinc finger
    72-94 C2H2-type zinc finger
    72-94 Zinc finger, C2H2 type
   90-109 Zinc-finger double domain
   99-122 C2H2-type zinc finger
  100-122 C2H2-type zinc finger
  100-122 Zinc finger, C2H2 type
  114-139 Zinc-finger double domain
  127-150 C2H2-type zinc finger
  128-150 C2H2-type zinc finger
  128-150 Zinc finger, C2H2 type
  142-166 Zinc-finger double domain
  156-170 C2H2-type zinc finger
  156-178 C2H2-type zinc finger
  156-178 Zinc finger, C2H2 type
  170-194 Zinc-finger double domain
  183-203 C2H2-type zinc finger
  184-206 Zinc finger, C2H2 type
  184-206 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 LNPKPHKKKSPGEKPHRCPQCGKCFARKSQLTGHQRIHSGEEPHKCPECGKRFLRSSDLY   60
  61 RHQRLHTGERPYECTVCKKRFTRRSHLIGHQRTHSEEETYKCLECGKSFCHGSSLKRHLK  120
 121 THTGEKPHRCHNCGKSFSRLTALTLHQRTHTEERPFKCNYCGKSFRQRPSLVIHLRIHTG  180
 181 EKPYKCTHCSKSFRQRAGLIMHQVTHFRGLI
Interface Residues: 5, 26, 27, 28, 29, 30, 32, 33, 35, 36, 37, 39, 54, 55, 56, 57, 58, 60, 61, 65, 68, 82, 83, 84, 85, 86, 89, 93, 110, 111, 112, 113, 114, 116, 117, 121, 138, 139, 140, 141, 142, 145, 151, 165, 166, 167, 168, 169, 170, 173, 174, 177, 194, 195, 196, 197, 198, 199, 200, 201, 202
3D-footprint Homologues: 7w1m_H, 8ssu_A, 5ei9_F, 1mey_C, 2kmk_A, 2gli_A, 8ssq_A, 2i13_A, 1llm_D, 6blw_A, 7ysf_A, 2jpa_A, 7n5w_A, 2wbs_A, 6u9q_A, 8gn3_A, 5kl3_A, 1f2i_J, 5und_A, 1tf6_A, 6ml4_A, 4x9j_A, 5kkq_D, 8h9h_G, 7eyi_G, 7y3m_I, 2lt7_A, 7luf_B, 6wmi_A, 5yj3_D, 1g2f_F, 5v3j_F, 5yel_A, 1tf3_A, 2drp_D, 5k5i_A, 7txc_E, 6e94_A, 1ubd_C, 7y3l_A, 6jnm_A, 8cuc_F, 6a57_A, 3uk3_C, 5k5l_F, 4m9v_C
Binding Motifs: ZNF449_3 rCGCCCAACC
ZNF449_4 rtCGCGaGCmArCAk
ZNF449_methyl_1 mmGCCCmACC
ZNF449_methyl_2 rtCGCGaGCMArCAk
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.