Transcription Factor
| Accessions: | 1zq3_P (3D-footprint 20250804) |
| Names: | BCD_DROME, Homeotic bicoid protein, Homeotic protein bicoid, PRD-4 |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P09081 |
| Length: | 68 |
| Pfam Domains: | 3-58 Homeobox domain 12-56 Homeodomain leucine-zipper encoding, Homez |
| Sequence: (in bold interface residues) | 1 GPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQ 60 61 SDQHKDQS |
| Interface Residues: | 3, 4, 5, 6, 44, 45, 47, 48, 51, 52, 54, 55, 56, 59 |
| 3D-footprint Homologues: | 3d1n_M, 8pmf_A, 6a8r_A, 1fjl_B, 5zfz_A, 1puf_A, 8ejp_B, 1ig7_A, 6fqp_B, 3cmy_A, 1jgg_B, 1nk2_P, 6m3d_C, 3lnq_A, 1zq3_P, 2lkx_A, 2ld5_A, 4cyc_A, 2r5y_A, 1puf_B, 8eml_B, 5hod_A, 2hos_A, 1au7_A, 5jlw_D, 9b8u_A, 6es3_K, 4xrs_G, 3a01_E, 8ik5_C, 7psx_B, 1b72_A, 3rkq_B, 5flv_I, 2hdd_A, 8osb_E, 7q3o_C, 5zjt_E, 7xrc_C, 1e3o_C, 2xsd_C, 1le8_A, 6fqq_E, 4qtr_D, 1xpx_A, 8g87_X, 1k61_B, 1o4x_A, 8bx1_A, 1mnm_C, 1du0_A |
| Binding Motifs: | 1zq3_P gGGAtTAG |
| Binding Sites: | 1zq3_A 1zq3_B |
| Publications: | Baird-Titus J.M, Clark-Baldwin K, Dave V, Caperelli C.A, Ma J, Rance M. The solution structure of the native K50 Bicoid homeodomain bound to the consensus TAATCC DNA-binding site. Journal of molecular biology 356:1137-51 (2006). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.