Transcription Factor

Accessions: NFIL3_DBD (HumanTF 1.0)
Names: E4 promoter-binding protein 4, Interleukin-3 promoter transcriptional activator, Interleukin-3-binding protein 1, NFIL3, NFIL3_HUMAN, Nuclear factor interleukin-3-regulated protein, Transcriptional activator NF-IL3A
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q16649
Notes: Ensembl ID: ENSG00000165030; DNA-binding domain sequence; TF family: bZIP; Clone source: Gene synthesis
Length: 102
Pfam Domains: 18-69 Basic region leucine zipper
25-69 bZIP transcription factor
76-102 Vertebrate interleukin-3 regulated transcription factor
Sequence:
(in bold interface residues)
1 NKSSACRRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENAT 60
61 LKAELLSLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSK
Interface Residues: 26, 29, 30, 32, 33, 36, 37
3D-footprint Homologues: 8k86_A, 6mg1_B, 1dh3_C
Binding Motifs: NFIL3_DBD yrTTACrTAAym
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.