Transcription Factor

Accessions: 1a1f_A (3D-footprint 20260701), 1a1g_A (3D-footprint 20260701)
Names: Early growth response protein 1, EGR-1, EGR1_MOUSE, Nerve growth factor-induced protein A, NGFI-A, THREE-FINGER ZIF268 PEPTIDE, Transcription factor Zif268, Zinc finger protein Krox-24, DSNR ZINC FINGER PEPTIDE
Organisms: Mus musculus
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P08046
Length: 84
Pfam Domains: 3-27 C2H2-type zinc finger
3-27 Zinc finger, C2H2 type
10-25 C2H2-type zinc finger
19-43 Zinc-finger double domain
33-55 C2H2-type zinc finger
33-55 Zinc finger, C2H2 type
33-55 C2H2-type zinc finger
47-71 Zinc-finger double domain
61-79 C2H2-type zinc finger
61-83 Zinc finger, C2H2 type
61-71 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 RPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKP 60
61 FACDICGRKFARSDERKRHTKIHL
Interface Residues: 15, 16, 17, 18, 19, 21, 22, 43, 44, 45, 46, 47, 49, 50, 51, 71, 72, 73, 74, 75, 76, 77, 78, 79
3D-footprint Homologues: 1tf3_A, 7n5w_A, 6jnm_A, 5kl3_A, 1ubd_C, 2kmk_A, 7ysf_A, 6ml4_A, 2drp_D, 8ssq_A, 7w1m_H, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 1tf6_A, 5ei9_F, 2jpa_A, 1g2f_F, 8h9h_G, 5v3j_F, 2lt7_A, 6e94_A, 6a57_A, 3uk3_C, 8cuc_F, 7y3l_A, 7txc_E, 5k5i_A, 1llm_D, 5yel_A, 2wbs_A, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D
Binding Motifs: 1a1f_A GCGTGGGAcc
1a1g_A GCCCaCGC
Binding Sites: 1a1f_B
1a1f_C
1a1g_B
1a1g_C
Publications: Elrod-Erickson M, Benson T.E, Pabo C.O. High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition. Structure (London, England : 1993) 6:451-64 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.