Transcription Factor
| Accessions: | 1a1f_A (3D-footprint 20260701), 1a1g_A (3D-footprint 20260701) |
| Names: | Early growth response protein 1, EGR-1, EGR1_MOUSE, Nerve growth factor-induced protein A, NGFI-A, THREE-FINGER ZIF268 PEPTIDE, Transcription factor Zif268, Zinc finger protein Krox-24, DSNR ZINC FINGER PEPTIDE |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P08046 |
| Length: | 84 |
| Pfam Domains: | 3-27 C2H2-type zinc finger 3-27 Zinc finger, C2H2 type 10-25 C2H2-type zinc finger 19-43 Zinc-finger double domain 33-55 C2H2-type zinc finger 33-55 Zinc finger, C2H2 type 33-55 C2H2-type zinc finger 47-71 Zinc-finger double domain 61-79 C2H2-type zinc finger 61-83 Zinc finger, C2H2 type 61-71 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 RPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKP 60 61 FACDICGRKFARSDERKRHTKIHL |
| Interface Residues: | 15, 16, 17, 18, 19, 21, 22, 43, 44, 45, 46, 47, 49, 50, 51, 71, 72, 73, 74, 75, 76, 77, 78, 79 |
| 3D-footprint Homologues: | 1tf3_A, 7n5w_A, 6jnm_A, 5kl3_A, 1ubd_C, 2kmk_A, 7ysf_A, 6ml4_A, 2drp_D, 8ssq_A, 7w1m_H, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 1tf6_A, 5ei9_F, 2jpa_A, 1g2f_F, 8h9h_G, 5v3j_F, 2lt7_A, 6e94_A, 6a57_A, 3uk3_C, 8cuc_F, 7y3l_A, 7txc_E, 5k5i_A, 1llm_D, 5yel_A, 2wbs_A, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D |
| Binding Motifs: | 1a1f_A GCGTGGGAcc 1a1g_A GCCCaCGC |
| Binding Sites: | 1a1f_B 1a1f_C 1a1g_B 1a1g_C |
| Publications: | Elrod-Erickson M, Benson T.E, Pabo C.O. High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition. Structure (London, England : 1993) 6:451-64 (1998). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.