Transcription Factor

Accessions: Nr2f6_DBD (HumanTF 1.0)
Names: COUP transcription factor 3, COUP-TF3, EAR-2, Nr2f6, NR2F6_MOUSE, Nuclear receptor subfamily 2 group F member 6, V-erbA-related protein 2
Organisms: Mus musculus
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: P43136
Notes: Ensembl ID: ENSMUSG00000002393; DNA-binding domain sequence; TF family: Nuclear_Receptor; Clone source: Hughes lab.
Length: 101
Pfam Domains: 19-87 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 GATSDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRTIRRNLSYTCRSNR 60
61 DCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHALPG
Interface Residues: 28, 29, 31, 32, 38, 39, 41, 42, 45, 46, 70, 92, 94, 96
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B
Binding Motifs: Nr2f6_DBD_1 rAGGTCAArAGGTCA
Nr2f6_DBD_2 rRGGTCAAAGGTCA
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.