Transcription Factor

Accessions: 4egz_B (3D-footprint 20241219)
Names: Arabinose metabolism transcriptional repressor, ARAR_BACSU
Organisms: Bacillus subtilis, strain 168
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P96711
Length: 83
Pfam Domains: 19-82 Bacterial regulatory proteins, gntR family
46-80 DeoR-like helix-turn-helix domain
46-77 HTH domain
Sequence:
(in bold interface residues)
1 HHLEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIR 60
61 KAIGDLVSQGLLYSVQGGGTFVA
Interface Residues: 20, 44, 45, 46, 49, 55, 56, 57, 58, 59, 60, 77
3D-footprint Homologues: 7zla_B, 6wg7_G, 6za3_B
Binding Motifs: 4egz_AB aTGTnnATnnACA
4egz_B TnnACAT
Binding Sites: 4egz_T
4egz_U
Publications: Jain D, Nair D.T. Spacing between core recognition motifs determines relative orientation of AraR monomers on bipartite operators. Nucleic acids research 41:639-47 (2013). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.