Transcription Factor

Accessions: 1mdm_B (3D-footprint 20231221)
Names: C-ETS-1 PROTEIN, ETS1_MOUSE, p54, Protein C-ets-1
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P27577
Length: 129
Pfam Domains: 27-108 Ets-domain
Sequence:
(in bold interface residues)
1 RDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDP 60
61 DEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEE 120
121 LHAMLDVKP
Interface Residues: 24, 57, 61, 62, 65, 79, 80, 82, 83, 84, 86, 87, 101
3D-footprint Homologues: 3zp5_A, 2wbs_A, 1dux_F, 4uno_A, 3jtg_A, 7jsa_J, 2stt_A, 8ee9_F, 4mhg_A, 4iri_A, 4l18_B, 1yo5_C, 1awc_A, 4lg0_B, 4bqa_A, 1bc8_C
Binding Motifs: 1mdm_AB CCAnGnnnnCnnnTCTCCG
1mdm_B CGGAna
Binding Sites: 1mdm_C
1mdm_D
Publications: Garvie C.W, Pufall M.A, Graves B.J, Wolberger C. Structural analysis of the autoinhibition of Ets-1 and its role in protein partnerships. The Journal of biological chemistry 277:45529-36 (2002). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.