Transcription Factor
| Accessions: | ZNF322 (humanC2H2ZF-ChIP Feb2015), Q6U7Q0 (JASPAR 2024) |
| Names: | ENSG00000181315, Q6U7Q0, ZNF322, Zinc finger protein 322, Zinc finger protein 322A, Zinc finger protein 388, Zinc finger protein 489, ZN322_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | humanC2H2ZF-ChIP Feb2015 1, JASPAR 2024 2 1 Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: C2H2 experiment: ChIP-seq/MEME/B1H-RC |
| Length: | 402 |
| Pfam Domains: | 42-53 C2H2-type zinc finger 63-81 Zinc-finger double domain 70-91 C2H2-type zinc finger 71-93 C2H2-type zinc finger 71-93 Zinc finger, C2H2 type 85-110 Zinc-finger double domain 98-121 C2H2-type zinc finger 99-121 C2H2-type zinc finger 114-137 Zinc-finger double domain 127-149 C2H2-type zinc finger 127-149 Zinc finger, C2H2 type 127-149 C2H2-type zinc finger 142-165 Zinc-finger double domain 155-177 Zinc finger, C2H2 type 155-177 C2H2-type zinc finger 155-177 C2H2-type zinc finger 169-193 Zinc-finger double domain 183-205 Zinc finger, C2H2 type 183-205 C2H2-type zinc finger 183-205 C2H2-type zinc finger 198-222 Zinc-finger double domain 210-233 C2H2-type zinc finger 211-233 Zinc finger, C2H2 type 211-233 C2H2-type zinc finger 228-249 Zinc-finger double domain 238-261 C2H2-type zinc finger 239-261 Zinc finger, C2H2 type 239-261 C2H2-type zinc finger 255-278 Zinc-finger double domain 266-289 C2H2-type zinc finger 267-289 Zinc finger, C2H2 type 267-289 C2H2-type zinc finger 355-373 C2H2-type zinc finger 355-373 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MYTSEEKCNQRTQKRKIYNVCPRKGKKIFIHMHEIIQIDGHIYQCLECKQNFCENLALIM 60 61 CERTHTGEKPYKCDMCEKTFVQSSDLTSHQRIHNYEKPYKCSKCEKSFWHHLALSGHQRT 120 121 HAGKKFYTCDICGKNFGQSSDLLVHQRSHTGEKPYLCSECDKCFSRSTNLIRHRRTHTGE 180 181 KPFKCLECEKAFSGKSDLISHQRTHTGERPYKCNKCEKSYRHRSAFIVHKRVHTGEKPYK 240 241 CGACEKCFGQKSDLIVHQRVHTGEKPYKCLECMRSFTRSANLIRHQATHTHTFKCLEYEK 300 301 SFNCSSDLIVHQRIHMEEKPHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCDKSF 360 361 HQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS |
| Interface Residues: | 54, 55, 57, 60, 82, 84, 85, 88, 110, 111, 112, 113, 116, 127, 137, 138, 139, 140, 141, 143, 144, 146, 147, 150, 165, 166, 167, 168, 169, 171, 172, 174, 176, 193, 194, 195, 196, 197, 199, 200, 203, 206, 220, 221, 222, 223, 224, 225, 228, 229, 232, 249, 250, 251, 252, 253, 254, 255, 256, 257, 277, 278, 279, 280, 281, 283, 284 |
| 3D-footprint Homologues: | 8ssu_A, 8ssq_A, 7w1m_H, 5und_A, 5v3j_F, 6ml4_A, 1mey_C, 5k5i_A, 1ubd_C, 2kmk_A, 6jnm_A, 8cuc_F, 1tf3_A, 1tf6_A, 2i13_A, 1llm_D, 6blw_A, 6u9q_A, 7txc_E, 5kl3_A, 6wmi_A, 2lt7_A, 7y3m_I, 6e94_A, 7ysf_A, 5yel_A, 2jpa_A, 1g2f_F, 5k5l_F, 4x9j_A, 5kkq_D, 2wbs_A, 1f2i_J, 5yj3_D, 7n5w_A, 2gli_A, 5ei9_F, 7eyi_G, 8h9h_G, 6a57_A, 3uk3_C, 8gn3_A, 2drp_D, 4m9v_C, 7y3l_A |
| Binding Motifs: | ZNF322_ChIP gwGcCTGsTACwswGCc UN0179.1 gwkCCTGCTACwswG UN0179.2 kCCTGCTACwswG |
| Binding Sites: | UN0179.1.1 UN0179.1.10 UN0179.1.11 / UN0179.1.6 UN0179.1.12 / UN0179.1.7 UN0179.1.13 / UN0179.1.8 UN0179.1.14 / UN0179.1.9 UN0179.1.10 / UN0179.1.15 UN0179.1.11 / UN0179.1.16 UN0179.1.17 UN0179.1.13 / UN0179.1.18 UN0179.1.14 / UN0179.1.19 UN0179.1.1 / UN0179.1.2 UN0179.1.15 / UN0179.1.20 UN0179.1.3 UN0179.1.4 UN0179.1.2 / UN0179.1.5 UN0179.1.3 / UN0179.1.6 UN0179.1.7 UN0179.1.4 / UN0179.1.8 UN0179.1.5 / UN0179.1.9 UN0179.1.12 UN0179.1.16 UN0179.1.17 UN0179.1.18 UN0179.1.19 UN0179.1.20 UN0179.2.1 UN0179.2.10 UN0179.2.11 UN0179.2.12 UN0179.2.13 UN0179.2.14 UN0179.2.15 UN0179.2.16 UN0179.2.17 / UN0179.2.20 UN0179.2.18 UN0179.2.19 UN0179.2.2 UN0179.2.3 UN0179.2.4 UN0179.2.5 UN0179.2.6 UN0179.2.7 UN0179.2.8 UN0179.2.9 |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.