Transcription Factor
| Accessions: | ZNF454 (humanC2H2ZF-ChIP Feb2015), Q8N9F8 (JASPAR 2024) |
| Names: | ENSG00000178187, Q8N9F8, ZNF454, ZN454_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | humanC2H2ZF-ChIP Feb2015 1, JASPAR 2024 2 1 Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: C2H2;KRAB experiment: ChIP-seq/MEME/B1H-RC |
| Length: | 522 |
| Pfam Domains: | 14-54 KRAB box 178-200 C2H2-type zinc finger 178-200 Zinc finger, C2H2 type 178-198 C2H2-type zinc finger 193-226 Zinc-finger double domain 216-238 C2H2-type zinc finger 216-238 Zinc finger, C2H2 type 216-232 C2H2-type zinc finger 234-254 Zinc-finger double domain 243-264 C2H2-type zinc finger 244-266 C2H2-type zinc finger 244-266 Zinc finger, C2H2 type 258-281 Zinc-finger double domain 272-294 Zinc finger, C2H2 type 287-311 Zinc-finger double domain 300-322 C2H2-type zinc finger 314-338 Zinc-finger double domain 327-348 C2H2-type zinc finger 328-350 C2H2-type zinc finger 328-350 Zinc finger, C2H2 type 343-365 Zinc-finger double domain 356-376 C2H2-type zinc finger 356-378 C2H2-type zinc finger 356-378 Zinc finger, C2H2 type 370-393 Zinc-finger double domain 383-404 C2H2-type zinc finger 384-406 Zinc finger, C2H2 type 384-406 C2H2-type zinc finger 399-421 Zinc-finger double domain 412-434 C2H2-type zinc finger 412-434 Zinc finger, C2H2 type 412-432 C2H2-type zinc finger 426-450 Zinc-finger double domain 439-460 C2H2-type zinc finger 440-462 C2H2-type zinc finger 440-462 Zinc finger, C2H2 type 454-477 Zinc-finger double domain 467-486 C2H2-type zinc finger 468-490 C2H2-type zinc finger 468-490 Zinc finger, C2H2 type 482-506 Zinc-finger double domain 495-518 C2H2-type zinc finger 496-518 C2H2-type zinc finger 496-518 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MAVSHLPTMVQESVTFKDVAILFTQEEWGQLSPAQRALYRDVMLENYSNLVSLGLLGPKP 60 61 DTFSQLEKREVWMPEDTPGGFCLDWMTMPASKKSTVKAEIPEEELDQWTIKERFSSSSHW 120 121 KCASLLEWQCGGQEISLQRVVLTHPNTPSQECDESGSTMSSSLHSDQSQGFQPSKNAFEC 180 181 SECGKVFSKSSTLNKHQKIHNEKNANQKIHIKEKRYECRECGKAFHQSTHLIHHQRIHTG 240 241 EKPYECKECGKAFSVSSSLTYHQKIHTGEKPFECNLCGKAFIRNIHLAHHHRIHTGEKPF 300 301 KCNICEKAFVCRAHLTKHQNIHSGEKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNE 360 361 CGKAFRVNSSLTEHQRIHTGEKPYKCNECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKA 420 421 FRDQSALAQHQRIHTGEKPYTCNICEKAFSDHSALTQHKRIHTREKPYKCKICEKAFIRS 480 481 THLTQHQRIHTGEKPYKCNKCGKAFNQTANLIQHQRHHIGEK |
| Interface Residues: | 189, 191, 192, 226, 227, 229, 230, 232, 233, 235, 236, 239, 254, 255, 257, 258, 261, 265, 282, 283, 284, 285, 286, 288, 289, 292, 311, 312, 313, 314, 316, 317, 321, 338, 339, 340, 341, 342, 345, 356, 366, 367, 368, 369, 370, 372, 373, 374, 377, 394, 395, 396, 397, 398, 399, 400, 401, 402, 422, 423, 424, 425, 426, 428, 429, 451, 452, 453, 454, 456, 457, 463, 477, 478, 479, 480, 481, 482, 485, 489, 506, 507, 508, 509, 510, 512, 513 |
| 3D-footprint Homologues: | 5k5l_F, 1tf3_A, 2jpa_A, 8cuc_F, 7y3l_A, 7w1m_H, 8ssu_A, 2wbs_A, 1tf6_A, 8gn3_A, 5kl3_A, 8ssq_A, 7y3m_I, 5yj3_D, 5yel_A, 5v3j_F, 2lt7_A, 6jnm_A, 2gli_A, 5ei9_F, 1g2f_F, 7txc_E, 2kmk_A, 3uk3_C, 5kkq_D, 4m9v_C, 6e94_A, 7ysf_A, 1ubd_C, 6u9q_A, 6ml4_A, 7n5w_A, 6blw_A, 5k5i_A, 4x9j_A, 1f2i_J, 2drp_D, 8h9h_G, 6a57_A, 1llm_D |
| Binding Motifs: | UN0193.1 TrGCGCCGGCGCyw UN0192.1 trGCGCCwGGCGCya ZNF454_ChIP AArGCwC MA1712.1 aGGCTCssGGcCCykvkG MA1712.2 GGCTCssGGcCCykvkG |
| Publications: | Schmitges FW, Radovani E, Najafabadi HS, Barazandeh M, Campitelli LF, Yin Y, Jolma A, Zhong G, Guo H, Kanagalingam T, Dai WF, Taipale J, Emili A, Greenblatt JF, Hughes TR. Multiparameter functional diversity of human C2H2 zinc finger proteins. Genome Res 26:1742-1752 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.