Transcription Factor
Accessions: | 4auw_E (3D-footprint 20241219) |
Names: | Kreisler, Maf-B, MAFB_MOUSE, Segmentation protein Kr, Transcription factor Maf-1, TRANSCRIPTION FACTOR MAFB, V-maf musculoaponeurotic fibrosarcoma oncogene homolog B |
Organisms: | Mus musculus |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P54841 |
Length: | 90 |
Pfam Domains: | 2-89 bZIP Maf transcription factor 29-89 bZIP transcription factor |
Sequence: (in bold interface residues) | 1 MFSDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENE 60 61 KTQLIQQVEQLKQEVSRLARERDAYKVKSE |
Interface Residues: | 35, 39, 42, 43, 44, 46, 47 |
3D-footprint Homologues: | 7x5e_F, 4eot_A, 7x5e_E, 6d6v_A |
Binding Motifs: | 4auw_E TGCtnnCg 4auw_EF TGCnAACGnTTGCA |
Binding Sites: | 4auw_H 4auw_G |
Publications: | Textor LC, Wilmanns M, Holton SJ. Expression, purification, crystallization and preliminary crystallographic analysis of the mouse transcription factor MafB in complex with its DNA-recognition motif Cmare. Acta Crystallogr Sect F Struct Biol Cryst Commun : (2007). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.