Transcription Factor

Accessions: H3G5R4 (JASPAR 2024)
Names: H3G5R4_PHYRM
Organisms: Phytophthora ramorum
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: H3G5R4
Length: 91
Pfam Domains: 7-31 C2H2-type zinc finger
7-31 Zinc finger, C2H2 type
23-50 Zinc-finger double domain
37-61 C2H2-type zinc finger
37-61 Zinc finger, C2H2 type
53-80 Zinc-finger double domain
67-91 C2H2-type zinc finger
73-91 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 SGAKPVFICTEVHCGKQFPRSFALRRHMRIHTGTKPYACDYEGCAQRFNTSGNLSRHKRI 60
61 HSGERPYPCIFATCGKRFNTSTKLKRHMRIH
Interface Residues: 19, 20, 21, 22, 23, 25, 26, 28, 29, 32, 46, 48, 49, 50, 51, 52, 53, 55, 56, 57, 60, 79, 80, 81, 82, 83, 84, 85, 86, 87, 90
3D-footprint Homologues: 7y3l_A, 7n5w_A, 6jnm_A, 1tf3_A, 3uk3_C, 7w1m_H, 8cuc_F, 1ubd_C, 8gn3_A, 4x9j_A, 2gli_A, 5kl3_A, 5ei9_F, 7ysf_A, 6ml4_A, 1tf6_A, 6blw_A, 2kmk_A, 1g2f_F, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 5k5i_A, 6a57_A, 2jpa_A, 8ssu_A, 5kkq_D, 8ssq_A, 1llm_D, 2wbs_A, 7txc_E, 1f2i_J, 6u9q_A, 5yel_A, 4m9v_C, 7y3m_I, 5yj3_D
Binding Motifs: UN0303.1 gCsCATCcyy
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.