Transcription Factor
Accessions: | H3G5R4 (JASPAR 2024) |
Names: | H3G5R4_PHYRM |
Organisms: | Phytophthora ramorum |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | H3G5R4 |
Length: | 91 |
Pfam Domains: | 7-31 Zinc finger, C2H2 type 7-31 C2H2-type zinc finger 23-50 Zinc-finger double domain 37-61 C2H2-type zinc finger 37-61 Zinc finger, C2H2 type 53-80 Zinc-finger double domain 67-91 C2H2-type zinc finger 73-91 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 SGAKPVFICTEVHCGKQFPRSFALRRHMRIHTGTKPYACDYEGCAQRFNTSGNLSRHKRI 60 61 HSGERPYPCIFATCGKRFNTSTKLKRHMRIH |
Interface Residues: | 19, 20, 21, 22, 23, 25, 26, 28, 29, 32, 46, 48, 49, 50, 51, 52, 53, 55, 56, 57, 60, 79, 80, 81, 82, 83, 84, 85, 86, 87, 90 |
3D-footprint Homologues: | 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 1tf3_A, 7w1m_H, 6jnm_A, 1ubd_C, 2kmk_A, 1mey_C, 6ml4_A, 2gli_A, 8gn3_A, 6blw_A, 4x9j_A, 2i13_A, 1g2f_F, 5kl3_A, 1tf6_A, 7ysf_A, 5ei9_F, 7eyi_G, 5v3j_F, 8h9h_G, 5k5i_A, 2lt7_A, 6e94_A, 6wmi_A, 6a57_A, 2jpa_A, 8ssu_A, 5kkq_D, 8ssq_A, 5und_A, 1f2i_J, 6u9q_A, 5yel_A, 7txc_E, 2wbs_A, 1llm_D, 4m9v_C, 7y3m_I, 5yj3_D |
Binding Motifs: | UN0303.1 gCsCATCcyy |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.