Transcription Factor

						

			
Accessions: H3G5R4 (JASPAR 2024)

			
Names: H3G5R4_PHYRM
Organisms: Phytophthora ramorum
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: H3G5R4
Length: 91
Pfam Domains:      7-31 Zinc finger, C2H2 type
     7-31 C2H2-type zinc finger
    23-50 Zinc-finger double domain
    37-61 C2H2-type zinc finger
    37-61 Zinc finger, C2H2 type
    53-80 Zinc-finger double domain
    67-91 C2H2-type zinc finger
    73-91 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 SGAKPVFICTEVHCGKQFPRSFALRRHMRIHTGTKPYACDYEGCAQRFNTSGNLSRHKRI   60
  61 HSGERPYPCIFATCGKRFNTSTKLKRHMRIH
Interface Residues: 19, 20, 21, 22, 23, 25, 26, 28, 29, 32, 46, 48, 49, 50, 51, 52, 53, 55, 56, 57, 60, 79, 80, 81, 82, 83, 84, 85, 86, 87, 90
3D-footprint Homologues: 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 1tf3_A, 7w1m_H, 6jnm_A, 1ubd_C, 2kmk_A, 1mey_C, 6ml4_A, 2gli_A, 8gn3_A, 6blw_A, 4x9j_A, 2i13_A, 1g2f_F, 5kl3_A, 1tf6_A, 7ysf_A, 5ei9_F, 7eyi_G, 5v3j_F, 8h9h_G, 5k5i_A, 2lt7_A, 6e94_A, 6wmi_A, 6a57_A, 2jpa_A, 8ssu_A, 5kkq_D, 8ssq_A, 5und_A, 1f2i_J, 6u9q_A, 5yel_A, 7txc_E, 2wbs_A, 1llm_D, 4m9v_C, 7y3m_I, 5yj3_D
Binding Motifs: UN0303.1 gCsCATCcyy
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.