Transcription Factor
| Accessions: | 5zjt_E (3D-footprint 20231221) |
| Names: | ABDB_DROME, Homeobox protein abdominal-B, IAB-7, Infraabdominal 7, P3, PH189 |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P09087 |
| Length: | 58 |
| Pfam Domains: | 1-56 Homeobox domain |
| Sequence: (in bold interface residues) | 1 KKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNS |
| Interface Residues: | 1, 2, 3, 6, 40, 41, 42, 44, 45, 48, 49, 52, 53, 56 |
| 3D-footprint Homologues: | 2lkx_A, 1nk2_P, 1zq3_P, 2ld5_A, 7q3o_C, 6es3_K, 2h1k_B, 1puf_A, 1jgg_B, 6a8r_A, 3a01_E, 5jlw_D, 3lnq_A, 1puf_B, 1au7_A, 4xrs_G, 3cmy_A, 2hdd_A, 6m3d_C, 1fjl_B, 5zfz_A, 2r5y_A, 1b72_A, 3d1n_M, 2hos_A, 7psx_B, 1ig7_A, 5zjt_E, 4cyc_A, 6cqi_A, 2xsd_C, 2h8r_B, 1e3o_C, 7xrc_C, 1le8_A, 1le8_B, 6fqp_B, 1du0_A, 5hod_A, 3l1p_A, 4qtr_D, 1mnm_C, 6fqq_E, 1k61_B, 3rkq_B, 8g87_X, 5flv_I, 1o4x_A |
| Binding Motifs: | 5zjt_E TTTATA |
| Binding Sites: | 5zjt_H 5zjt_G |
| Publications: | Zeiske T, Baburajendran N, Kaczynska A, Brasch J, Palmer AG 3rd, Shapiro L, Honig B, Mann RS. Intrinsic DNA Shape Accounts for Affinity Differences between Hox-Cofactor Binding Sites. Cell Rep 24:2221-2230 (2018). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.