Transcription Factor

Accessions: T049287_1.02 (CISBP 1.02), Q9WVG7 (JASPAR 2024)
Names: Osr1, T049287_1.02;, OSR1_MOUSE
Organisms: Mus musculus
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 266
Pfam Domains: 175-197 Zinc finger, C2H2 type
189-213 Zinc-finger double domain
203-225 Zinc finger, C2H2 type
217-240 Zinc-finger double domain
231-253 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYP 60
61 AMHLPRSSFSKVPGAVSSLMDARFQLPAFPWFPHVIHPKPEITAGGSGAALKTKPRFDFA 120
121 NLALAATQEDPTKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFC 180
181 GRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGF 240
241 CQSRTLAVHKTLHSQVKELKTSKIKC
Interface Residues: 152, 154, 155, 158, 165, 175, 185, 186, 187, 188, 189, 191, 192, 193, 198, 199, 200, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 224, 241, 242, 243, 244, 245, 246, 248
3D-footprint Homologues: 6ml4_A, 1ubd_C, 2kmk_A, 6jnm_A, 3uk3_C, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 1g2f_F, 5kl3_A, 5ei9_F, 2jpa_A, 1llm_D, 6blw_A, 5k5i_A, 6u9q_A, 2drp_D, 5kkq_D, 1tf6_A, 4x9j_A, 2gli_A, 8h9h_G, 5v3j_F, 4m9v_C, 7y3m_I, 7ysf_A, 6e94_A, 2lt7_A, 6a57_A, 7w1m_H, 1yuj_A, 2wbs_A, 7txc_E, 8ssq_A, 5yel_A, 1f2i_J, 8gn3_A, 5yj3_D
Binding Motifs: PB0050.1 htwwACrGTAGCwmwr
PB0154.1 ryayGCTACywrmwhm
M0431_1.02 acrGwAGca
Publications: Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.