Transcription Factor
| Accessions: | 1hf0_A (3D-footprint 20260701), 1hf0_B (3D-footprint 20260701) |
| Names: | NF-A1, Oct-1, Octamer-binding protein 1, OCTAMER-BINDING TRANSCRIPTION FACTOR 1, OTF-1, PO2F1_HUMAN, POU domain, class 2, transcription factor 1 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P14859 |
| Length: | 128 |
| Pfam Domains: | 1-70 Pou domain - N-terminal to homeobox domain 71-127 Homeobox domain |
| Sequence: (in bold interface residues) | 1 LEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKP 60 61 LLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSN 120 121 RRQKEKRI |
| Interface Residues: | 22, 38, 39, 40, 41, 43, 44, 50, 54, 62, 71, 72, 73, 74, 78, 79, 82, 83, 112, 113, 115, 116, 119, 120, 122, 123, 124, 127 |
| 3D-footprint Homologues: | 3d1n_M, 7u0g_M, 8bx1_A, 7xrc_C, 2xsd_C, 7xzx_N, 1e3o_C, 1au7_A, 3q05_B, 1o4x_A, 7xzz_N, 8g87_X, 1lq1_D, 1ig7_A, 8ejp_B, 6a8r_A, 8pmf_A, 1fjl_B, 3cmy_A, 5zfz_A, 2r5y_A, 1puf_A, 6m3d_C, 1zq3_P, 1nk2_P, 2lkx_A, 7q3o_C, 6es3_K, 2hos_A, 8ik5_C, 5zjt_E, 5hod_A, 3a01_E, 8eml_B, 4xrs_G, 2hdd_A, 1b72_A, 2ld5_A, 5jlw_D, 8osb_E, 1le8_A, 5flv_I, 1du0_A, 4cyc_A, 1jgg_B, 7psx_B, 3lnq_A, 4qtr_D, 2d5v_B, 1k61_B, 3rkq_B, 9b8u_A |
| Binding Motifs: | 1hf0_AB CGTTTGAAAGGCAAATG 1hf0_B TTTCAAAcG |
| Binding Sites: | 1hf0_M 1hf0_N |
| Publications: | Reményi A, Tomilin A, Pohl E, Lins K, Philippsen A, Reinbold R, Schöler H.R, Wilmanns M. Differential dimer activities of the transcription factor Oct-1 by DNA-induced interface swapping. Molecular cell 8:569-80 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.