Transcription Factor
Accessions: | 1cf7_B (3D-footprint 20231221) |
Names: | E2F dimerization partner 2, TFDP2_HUMAN, TRANSCRIPTION FACTOR DP-2 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q14188 |
Length: | 82 |
Pfam Domains: | 2-80 E2F/DP family winged-helix DNA-binding domain |
Sequence: (in bold interface residues) | 1 GKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNIRRRVYDAL 60 61 NVLMAMNIISKEKKEIKWIGLP |
Interface Residues: | 42, 51, 53, 54, 55, 57 |
3D-footprint Homologues: | 4lb5_B, 1cf7_B, 4yo2_A, 1cf7_A |
Binding Motifs: | 1cf7_AB TCGCGCG 1cf7_B CGCGa |
Binding Sites: | 1cf7_C 1cf7_D |
Publications: | Zheng N., Fraenkel E., Pabo C. O., Pavletich N. P. Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP. Genes Dev. 13:666-674 (1999). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.