Transcription Factor

Accessions: T057850_1.02 (CISBP 1.02)
Names: CG4854, T057850_1.02;
Organisms: Drosophila melanogaster
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:B1H, family:C2H2 ZF
Length: 319
Pfam Domains: 12-80 Zinc-finger associated domain (zf-AD)
178-200 Zinc finger, C2H2 type
178-200 C2H2-type zinc finger
178-201 C2H2-type zinc finger
193-216 Zinc-finger double domain
205-228 C2H2-type zinc finger
206-228 Zinc finger, C2H2 type
206-228 C2H2-type zinc finger
221-244 Zinc-finger double domain
233-244 C2H2-type zinc finger
234-256 Zinc finger, C2H2 type
234-256 C2H2-type zinc finger
251-272 Zinc-finger double domain
261-284 C2H2-type zinc finger
262-284 Zinc finger, C2H2 type
262-284 C2H2-type zinc finger
277-300 Zinc-finger double domain
290-300 C2H2-type zinc finger
290-312 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MHTNVDSRDLKCRICLVQPKDESLMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALL 60
61 LRAALKLRSLCQQTEKDLKEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGSDSELEY 120
121 EYLDSYDVTLESSEDVACSADELVSIEPAISAPEESVYSLSPKPVTFEDEDSGQAASFTC 180
181 NICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCD 240
241 SRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFS 300
301 QLHHKNSHEKSHKRTKEVK
Interface Residues: 188, 189, 190, 191, 192, 195, 196, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 229, 244, 245, 246, 247, 248, 251, 254, 255, 272, 273, 274, 275, 276, 277, 278, 279, 301, 302, 303, 304, 307
3D-footprint Homologues: 1tf3_A, 7w1m_H, 5und_A, 5k5i_A, 8ssu_A, 5v3j_F, 2gli_A, 1tf6_A, 6wmi_A, 7eyi_G, 4m9v_C, 2i13_A, 7ysf_A, 8ssq_A, 7n5w_A, 2kmk_A, 6ml4_A, 6blw_A, 5kkq_D, 7txc_E, 5ei9_F, 8h9h_G, 2lt7_A, 6e94_A, 5yel_A, 2jpa_A, 1ubd_C, 6jnm_A, 1mey_C, 1f2i_J, 1g2f_F, 6u9q_A, 4x9j_A, 5kl3_A, 6a57_A, 3uk3_C, 8cuc_F, 7y3l_A, 2drp_D, 8gn3_A, 1llm_D, 2wbs_A, 7y3m_I, 5yj3_D
Binding Motifs: M4867_1.02 GtgGTTGGCAAC
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.