Transcription Factor
| Accessions: | Q9NR55 (JASPAR 2024) |
| Names: | 21 kDa small nuclear factor isolated from T-cells, B-ATF-3, Basic leucine zipper transcriptional factor ATF-like 3, BATF3_HUMAN, Jun dimerization protein p21SNFT |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q9NR55 |
| Length: | 127 |
| Pfam Domains: | 33-93 bZIP transcription factor 34-87 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKA 60 61 DKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDP 120 121 VAGCLPR |
| Interface Residues: | 41, 42, 44, 45, 46, 48, 49, 50, 52, 53, 54, 56, 58 |
| 3D-footprint Homologues: | 1skn_P, 6mg1_B, 7x5e_F, 5t2h_A, 1nwq_C, 5vpe_D, 2c9l_Z, 5t01_B |
| Binding Motifs: | MA0835.1 TGATGACGTCATCr MA0835.2 waTGACTCAtw MA0835.3 TGACTCA |
| Binding Sites: | MA0835.3.14 / MA0835.3.19 / MA0835.3.2 / MA0835.3.20 / MA0835.3.5 / MA0835.3.6 / MA0835.3.7 / MA0835.3.8 / MA0835.3.9 MA0835.3.12 MA0835.3.10 / MA0835.3.17 MA0835.3.13 / MA0835.3.18 MA0835.3.11 / MA0835.3.16 MA0835.3.15 / MA0835.3.3 MA0835.2.1 / MA0835.2.2 MA0835.2.10 / MA0835.2.9 MA0835.2.10 / MA0835.2.11 MA0835.2.11 / MA0835.2.12 MA0835.2.12 / MA0835.2.13 MA0835.2.13 / MA0835.2.14 / MA0835.2.18 / MA0835.2.19 MA0835.2.14 / MA0835.2.15 / MA0835.2.19 / MA0835.2.20 MA0835.2.15 / MA0835.2.16 MA0835.2.16 / MA0835.2.17 MA0835.2.17 / MA0835.2.18 MA0835.2.2 / MA0835.2.3 MA0835.2.3 / MA0835.2.4 MA0835.2.4 / MA0835.2.5 MA0835.2.5 MA0835.2.6 MA0835.2.7 MA0835.2.8 MA0835.2.9 MA0835.2.1 MA0835.2.20 MA0835.3.1 MA0835.3.4 |
| Publications: | Hai T., Liu F., Coukos W. J., Green M. R. Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers. Genes Dev. 3:2083-2090 (1989). [Pubmed] Schleussner N, Merkel O, Costanza M, Liang HC, Hummel F, Romagnani C, Durek P, Anagnostopoulos I, Hummel M, Jöhrens K, Niedobitek A, Griffin PR, Piva R, Sczakiel HL, Woessmann W, Damm-Welk C, Hinze C, Stoiber D, Gillissen B, Turner SD, Kaergel E, von Hoff L, Grau M, Lenz G, Dörken B, Scheidereit C, Kenner L, Janz M, Mathas S. The AP-1-BATF and -BATF3 module is essential for growth, survival and TH17/ILC3 skewing of anaplastic large cell lymphoma. Leukemia 32:1994-2007 (2018). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.