Transcription Factor
| Accessions: | T05420 (AthalianaCistrome v4_May2016), Q9C517 (JASPAR 2024) |
| Names: | AT1G66420, T05420;, Probable transcription factor At1g66420, STKLE_ARATH, Storekeeper-like protein At1g66420 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | AthalianaCistrome v4_May2016 1, JASPAR 2024 2 1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: DAP-seq, family:GeBP |
| Length: | 282 |
| Pfam Domains: | 86-175 Protein of unknown function, DUF573 |
| Sequence: | MSKKHLKPLETCFEDEEDDVIYLPPGLVTGATSKKNEEFCGGSGKVQPSEMKRRSEGTST DMTSKRAKKVSAEDEKKVGEWTKNPYFQRLWSEEDEIVMLQGIIKFEDVTGKSPFEDRHG FIEFVKNSISFEASVQQYIGKISQLKRKYTRKRKNGFSEGHEQKCFKLAMSIWGTKETSK KTDLCSSPKGKKVKEEDGDVTNSDWFENSFLLPSIESLGVDSVKRKWNVVPMEFKKKIEE RLELLEADESECKKMEEMLKVKNSECVKQKTNLLNEVIDVMT |
| Binding Motifs: | M0404 AacmTTATCCATwwmttak UN0389.1 AacmTTATCCATwwmttak UN0389.2 AacmTTATCCATwwmtt |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.