Transcription Factor

						

			
Accessions: 2bop_A (3D-footprint 20231221)

			
Names: VE2_BPV1
Organisms: Bovine papillomavirus type 1
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03122
Length: 85
Pfam Domains:      5-78 E2 (early) protein, C terminal
Sequence: 
(in bold interface residues)		   1 SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQ   60
  61 RQDFLKHVPLPPGMNISGFTASLDF
Interface Residues: 11, 14, 15, 18, 19
3D-footprint Homologues: 2ayg_A, 1jj4_B, 2bop_A
Binding Motifs: 2bop_A CGGt
Binding Sites: 2bop_B
			
Publications: Hegde R.S, Grossman S.R, Laimins L.A, Sigler P.B. Crystal structure at 1.7 A of the bovine papillomavirus-1 E2 DNA-binding domain bound to its DNA target. Nature 359:505-12 (1992). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.