Transcription Factor

Accessions: esg-F3-5 (FlyZincFinger 1.0 )
Names: CG3758
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 87
Pfam Domains: 5-26 C2H2-type zinc finger
5-26 C2H2-type zinc finger
5-26 Zinc finger, C2H2 type
19-42 Zinc-finger double domain
23-74 CHY zinc finger
32-54 C2H2-type zinc finger
32-52 Zinc-finger of C2H2 type
32-54 C2H2-type zinc finger
32-54 Zinc finger, C2H2 type
46-71 Zinc-finger double domain
60-78 Zinc finger, C2H2 type
60-84 C2H2-type zinc finger
60-78 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 TLPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKY 60
61 SCTSCSKTFSRMSLLTKHSEGGCPGGS
Interface Residues: 14, 15, 16, 17, 18, 20, 21, 22, 42, 43, 44, 45, 46, 47, 48, 49, 50, 53, 70, 71, 72, 73, 74, 76, 77
3D-footprint Homologues: 7n5w_A, 6jnm_A, 3uk3_C, 1tf3_A, 8cuc_F, 7y3l_A, 5ei9_F, 2jpa_A, 1g2f_F, 5kl3_A, 1ubd_C, 5k5i_A, 2kmk_A, 1llm_D, 7ysf_A, 8ssq_A, 7w1m_H, 6blw_A, 6u9q_A, 5yel_A, 4x9j_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 1tf6_A, 8h9h_G, 4m9v_C, 7y3m_I, 2lt7_A, 6e94_A, 6a57_A, 5yj3_D, 7txc_E, 6ml4_A, 2drp_D, 5k5l_F, 2wbs_A, 8gn3_A, 5v3j_F
Binding Motifs: esg-F3-5_SOLEXA_FBgn0001981 GCAGGTGyatkkgkk
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.