Transcription Factor

Accessions: T000648_1.02 (CISBP 1.02), Q9LTC5 (JASPAR 2024)
Names: AT3G23230, T000648_1.02;, ERF98_ARATH
Organisms: Arabidopsis thaliana
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:AP2
Length: 139
Pfam Domains: 19-70 AP2 domain
Sequence:
(in bold interface residues)
1 MESSNRSSNNQSQDDKQARFRGVRRRPWGKFAAEIRDPSRNGARLWLGTFETAEEAARAY 60
61 DRAAFNLRGHLAILNFPNEYYPRMDDYSLRPPYASSSSSSSSGSTSTNVSRQNQREVFEF 120
121 EYLDDKVLEELLDSEERKR
Interface Residues: 24, 26, 28, 32, 34, 36, 44, 46, 79, 80, 83, 84
3D-footprint Homologues: 7wq5_A, 1gcc_A, 5wx9_A, 8dc2_A
Binding Motifs: M0024_1.02 scGCCGcc
MA0999.1 scGCCGcc
Publications: Hao D., Ohme-Takagi M., Sarai A. Unique mode of GCC box recognition by the DNA-binding domain of ethylene-responsive element-binding factor (ERF domain) in plant. J. Biol. Chem. 273:26857-26861 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.