Transcription Factor
| Accessions: | 3l1p_A (3D-footprint 20231221) |
| Names: | NF-A3, Oct-3, Oct-4, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3, OTF-3, PO5F1_MOUSE, POU domain, class 5, transcription factor 1 |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P20263 |
| Length: | 147 |
| Pfam Domains: | 3-75 Pou domain - N-terminal to homeobox domain 91-147 Homeobox domain |
| Sequence: (in bold interface residues) | 1 DMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTISRFEALQLSLKNM 60 61 SKLRPLLEKWVEEADNNENLQEISKSVQARKRKRTSIENRVRWSLETMFLKSPKPSLQQI 120 121 THIANQLGLEKDVVRVWFSNRRQKGKR |
| Interface Residues: | 27, 43, 44, 45, 46, 48, 49, 55, 59, 91, 92, 93, 94, 95, 132, 135, 136, 139, 140, 143, 144, 147 |
| 3D-footprint Homologues: | 3d1n_M, 7u0g_M, 3l1p_A, 8g87_X, 1o4x_A, 1e3o_C, 1au7_A, 2xsd_C, 7xrc_C, 2h1k_B, 6a8r_A, 1zq3_P, 2lkx_A, 1nk2_P, 1b72_A, 5hod_A, 1puf_B, 5jlw_D, 1ig7_A, 7q3o_C, 1le8_A, 3lnq_A, 2hdd_A, 6es3_K, 4xrs_G, 3cmy_A, 5zfz_A, 3rkq_B, 1du0_A, 5flv_I, 2d5v_B, 1jgg_B, 5zjt_E, 4cyc_A, 2r5y_A, 1puf_A, 4qtr_D, 1fjl_B |
| Binding Motifs: | 3l1p_A CATTTsAAA 3l1p_AB CATTTGCCTTTCAAATG |
| Binding Sites: | 3l1p_M 3l1p_N |
| Publications: | Esch D, Vahokoski J, Groves M.R, Pogenberg V, Cojocaru V, Vom Bruch H, Han D, Drexler H.C, Araúzo-Bravo M.J, Ng C.K, Jauch R, Wilmanns M, Schöler H.R. A unique Oct4 interface is crucial for reprogramming to pluripotency. Nature cell biology 15:295-301 (2013). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.