Transcription Factor

Accessions: HSF2_DBD (HumanTF 1.0)
Names: Heat shock factor protein 2, Heat shock transcription factor 2, HSF 2, HSF2, HSF2_HUMAN, HSTF 2
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q03933
Notes: Ensembl ID: ENSG00000025156; DNA-binding domain sequence; TF family: HSF; Clone source: MGC
Length: 218
Pfam Domains: 9-113 HSF-type DNA-binding
Sequence:
(in bold interface residues)
1 MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMAS 60
61 FVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENK 120
121 IRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQ 180
181 FIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVK
Interface Residues: 54, 55, 60, 62, 63, 64, 66, 67, 109
3D-footprint Homologues: 5hdn_C, 5d5v_B, 5d5w_B, 3hts_B, 7dci_A
Binding Motifs: HSF2_DBD TTCTAGAAyrTTC
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.