Transcription Factor
| Accessions: | ECK120006033 (RegulonDB 7.5) |
| Names: | EvgA, EvgA transcriptional regulator |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | two component regulatory systems (external signal); activator; Transcription related; cytoplasm; intracellular signal transduction; sequence-specific DNA binding; two-component response regulator activity; transcription, DNA-dependent; intracellular; two-component signal transduction system (phosphorelay); DNA binding; sequence-specific DNA binding transcription factor activity; regulation of transcription, DNA-dependent |
| Length: | 205 |
| Pfam Domains: | 4-113 Response regulator receiver domain 142-198 Bacterial regulatory proteins, luxR family |
| Sequence: (in bold interface residues) | 1 MNAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNG 60 61 IQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGY 120 121 CYFPFSLNRFVGSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKS 180 181 RLMEKLECKSLMDLYTFAQRNKIG* |
| Interface Residues: | 171, 172, 173, 174, 176, 177, 178, 180 |
| 3D-footprint Homologues: | 7ve5_B, 5w43_B, 1zlk_A, 4wuh_B |
| Binding Motifs: | EvgA TkCYTACAmCTGTARGA |
| Binding Sites: | ECK120015622 ECK120033915 ECK120033917 ECK120033919 ECK120033923 ECK120048907 ECK120051344 |
| Publications: | Eguchi Y., Itou J., Yamane M., Demizu R., Yamato F., Okada A., Mori H., Kato A., Utsumi R. B1500, a small membrane protein, connects the two-component systems EvgS/EvgA and PhoQ/PhoP in Escherichia coli. Proc Natl Acad Sci U S A. 104(47):18712-7 (2007). [Pubmed] Ma Z., Masuda N., Foster JW. Characterization of EvgAS-YdeO-GadE branched regulatory circuit governing glutamate-dependent acid resistance in Escherichia coli. J Bacteriol. 186(21):7378-89 (2004). [Pubmed] Sayed AK., Foster JW. A 750 bp sensory integration region directs global control of the Escherichia coli GadE acid resistance regulator. Mol Microbiol. 71(6):1435-50 (2009). [Pubmed] Sayed AK., Odom C., Foster JW. The Escherichia coli AraC-family regulators GadX and GadW activate gadE, the central activator of glutamate-dependent acid resistance. Microbiology. 153(Pt 8):2584-92 (2007). [Pubmed] Ma Z., Gong S., Richard H., Tucker DL., Conway T., Foster JW. GadE (YhiE) activates glutamate decarboxylase-dependent acid resistance in Escherichia coli K-12. Mol Microbiol. 49(5):1309-20 (2003). [Pubmed] Masuda N., Church GM. Escherichia coli gene expression responsive to levels of the response regulator EvgA. J Bacteriol. 184(22):6225-34 (2002). [Pubmed] Masuda N., Church GM. Regulatory network of acid resistance genes in Escherichia coli. Mol Microbiol. 48(3):699-712 (2003). [Pubmed] Nishino K., Senda Y., Hayashi-Nishino M., Yamaguchi A. Role of the AraC-XylS family regulator YdeO in multi-drug resistance of Escherichia coli. J Antibiot (Tokyo). 62(5):251-7 (2009). [Pubmed] Bantscheff M., Perraud AL., Bock A., Rippe K., Weiss V., Glocker M., Gross R. Structure-function relationships in the Bvg and Evg two-component phosphorelay systems. Int J Med Microbiol. 290(4-5):317-23 (2000). [Pubmed] Perraud AL., Kimmel B., Weiss V., Gross R. Specificity of the BvgAS and EvgAS phosphorelay is mediated by the C-terminal HPt domains of the sensor proteins. Mol Microbiol. 27(5):875-87 (1998). [Pubmed] Foster JW. Escherichia coli acid resistance: tales of an amateur acidophile. Nat Rev Microbiol. 2(11):898-907 (2004). [Pubmed] Nishino K., Inazumi Y., Yamaguchi A. Global analysis of genes regulated by EvgA of the two-component regulatory system in Escherichia coli. J Bacteriol. 185(8):2667-72 (2003). [Pubmed] Tanabe H., Masuda T., Yamasaki K., Katoh A., Yoshioka S., Utsumi R. Molecular interaction between proteins involved in EvgAS signal transduction of Escherichia coli. Biosci Biotechnol Biochem. 62(1):78-82 (1998). [Pubmed] Itou J., Eguchi Y., Utsumi R. Molecular mechanism of transcriptional cascade initiated by the EvgS/EvgA system in Escherichia coli K-12. Biosci Biotechnol Biochem. 73(4):870-8 (2009). [Pubmed] Eguchi Y., Oshima T., Mori H., Aono R., Yamamoto K., Ishihama A., Utsumi R. Transcriptional regulation of drug efflux genes by EvgAS, a two-component system in Escherichia coli. Microbiology. 149(Pt 10):2819-28 (2003). [Pubmed] Utsumi R., Katayama S., Ikeda M., Igaki S., Nakagawa H., Miwa A., Taniguchi M., Noda M. Cloning and sequence analysis of the evgAS genes involved in signal transduction of Escherichia coli K-12. Nucleic Acids Symp Ser (27):149-50 (1992). [Pubmed] Martin RG., Rosner JL. The AraC transcriptional activators. Curr Opin Microbiol. 4(2):132-7 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.