Transcription Factor
| Accessions: | 3qoq_C (3D-footprint 20231221) |
| Names: | Alginate and motility regulator Z, AMRZ_PSEAE, Transcription factor AmrZ |
| Organisms: | Pseudomonas aeruginosa, strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1 |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | G3XCY4 |
| Length: | 49 |
| Pfam Domains: | 4-49 Arc-like DNA binding domain |
| Sequence: (in bold interface residues) | 1 TYSSRTADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEG |
| Interface Residues: | 9, 11, 13, 29, 48 |
| 3D-footprint Homologues: | 1bdt_C, 3qoq_B, 1lwt_A, 4c2u_D |
| Binding Motifs: | 3qoq_ABCD TtGGCAnnaCGCC |
| Publications: | Pryor E.E, Waligora E.A, Xu B, Dellos-Nolan S, Wozniak D.J, Hollis T. The transcription factor AmrZ utilizes multiple DNA binding modes to recognize activator and repressor sequences of Pseudomonas aeruginosa virulence genes. PLoS pathogens 8:e1002648 (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.