Transcription Factor

Accessions: 3qoq_C (3D-footprint 20241219)
Names: Alginate and motility regulator Z, AMRZ_PSEAE, Transcription factor AmrZ
Organisms: Pseudomonas aeruginosa, strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: G3XCY4
Length: 49
Pfam Domains: 4-49 Arc-like DNA binding domain
Sequence:
(in bold interface residues)
1 TYSSRTADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEG
Interface Residues: 48
3D-footprint Homologues: 4c2u_D
Binding Motifs: 3qoq_ABCD TtGGCAnnaCGCC
Publications: Pryor E.E, Waligora E.A, Xu B, Dellos-Nolan S, Wozniak D.J, Hollis T. The transcription factor AmrZ utilizes multiple DNA binding modes to recognize activator and repressor sequences of Pseudomonas aeruginosa virulence genes. PLoS pathogens 8:e1002648 (2012). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.