Transcription Factor

						

			
Accessions: 4auw_A (3D-footprint 20231221)

			
Names: Kreisler, Maf-B, MAFB_MOUSE, Segmentation protein Kr, Transcription factor Maf-1, TRANSCRIPTION FACTOR MAFB, V-maf musculoaponeurotic fibrosarcoma oncogene homolog B
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P54841
Length: 87
Pfam Domains:      1-86 bZIP Maf transcription factor
    27-86 bZIP transcription factor
Sequence: 
(in bold interface residues)		   1 SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKT   60
  61 QLIQQVEQLKQEVSRLARERDAYKVKS
Interface Residues: 33, 37, 38, 40, 41, 42, 44, 45
3D-footprint Homologues: 2wt7_B, 7x5e_E, 4eot_A, 7x5e_F, 5vpe_D, 6d6v_A
Binding Motifs: 4auw_AB TGCtnACGTnarCA
			
Publications: Textor LC, Wilmanns M, Holton SJ. Expression, purification, crystallization and preliminary crystallographic analysis of the mouse transcription factor MafB in complex with its DNA-recognition motif Cmare. Acta Crystallogr Sect F Struct Biol Cryst Commun : (2007). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.