Transcription Factor
| Accessions: | JUNB_HUMAN (HOCOMOCO 10), P17275 (JASPAR 2024) |
| Names: | JUNB_HUMAN, Transcription factor AP-1 subunit JunB, Transcription factor JunB |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 347 |
| Pfam Domains: | 5-257 Jun-like transcription factor 266-329 bZIP transcription factor 273-326 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGP 60 61 EGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG 120 121 AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPP 180 181 VYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFK 240 241 EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV 300 301 KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF |
| Interface Residues: | 263, 264, 267, 268, 274, 275, 277, 278, 279, 281, 282, 285, 286, 289 |
| 3D-footprint Homologues: | 5i50_B, 7x5e_E, 2wt7_B, 1skn_P, 7x5e_F, 4eot_A, 2wt7_A, 1gd2_G, 8k86_A, 6mg1_B, 5vpe_C, 5vpe_D, 2dgc_A, 5t01_B |
| Binding Motifs: | MA0490.1 grrTGAsTCAk MA1140.2 gATGACGTCAyc JUNB_HUMAN.H10MO.C|M01281 ggrTGAGTCAy MA1132.1 kaTGACkCAt MA1133.1 krTGACGTCATb MA1134.1 krTGAsTCAymv MA1135.1 krTGAsTCAy MA1136.1 rTGACGTCAy MA1137.1 ykrTGAcTMAtmc MA1138.1 krTGAsTCAy MA1139.1 krTGACGTCAym MA1140.1 rTkACGTmAy MA0490.2 wdATGACTCATwh MA0490.3 ATGACTCAT MA1132.2 aTGACkCA MA1133.2 krTGACGTCAT MA1134.2 rTGAsTCAy MA1137.2 rTGAcTMAt MA1138.2 rTGAsTCAy MA1139.2 rTGACGTCAy MA1140.3 ATGACGTCAyc |
| Binding Sites: | MA0490.1.1 MA0490.1.10 MA0490.1.11 MA0490.1.12 MA0490.1.13 MA0490.1.14 MA0490.1.15 MA0490.1.16 MA0490.1.17 MA0490.1.18 MA0490.1.19 MA0490.1.2 MA0490.1.20 MA0490.1.3 MA0490.1.4 MA0490.1.5 MA0490.1.6 MA0490.1.7 MA0490.1.8 MA0490.1.9 MA0490.2.1 MA0490.2.8 MA0490.2.4 / MA0490.2.9 MA0490.2.10 MA0490.2.11 / MA0490.2.5 MA0490.2.2 MA0490.2.2 / MA0490.2.4 MA0490.2.12 / MA0490.2.6 MA0490.2.13 MA0490.2.14 / MA0490.2.7 MA0490.2.15 MA0490.2.16 MA0490.2.17 / MA0490.2.8 MA0490.2.18 / MA0490.2.9 MA0490.2.10 / MA0490.2.19 MA0490.2.11 / MA0490.2.20 MA0490.2.3 MA0490.2.5 MA0490.2.6 MA0490.2.3 / MA0490.2.7 MA0490.2.12 MA0490.2.13 MA0490.2.14 MA0490.2.15 MA0490.2.16 MA0490.2.17 MA0490.2.18 MA0490.2.19 MA0490.2.20 MA0490.3.1 MA0490.3.8 MA0490.3.7 MA0490.3.9 MA0490.3.10 MA0490.3.11 / MA0490.3.18 MA0490.3.12 MA0490.3.13 MA0490.3.2 MA0490.3.5 / MA0490.3.6 MA0490.3.4 MA0490.3.14 / MA0490.3.17 MA0490.3.15 / MA0490.3.16 MA0490.3.19 MA0490.3.20 MA0490.3.3 |
| Publications: | Li M, Ge Q, Wang W, Wang J, Lu Z. c-Jun binding site identification in K562 cells. Journal of genetics and genomics = Yi chuan xue bao 38:235-42 (2011). [Pubmed] Colin L, Vandenhoudt N, de Walque S, Van Driessche B, Bergamaschi A, Martinelli V, Cherrier T, Vanhulle C, Guiguen A, David A, Burny A, Herbein G, Pancino G, Rohr O, Van Lint C. The AP-1 binding sites located in the pol gene intragenic regulatory region of HIV-1 are important for viral replication. PloS one 6:e19084 (2011). [Pubmed] Shaulian E, Karin M. AP-1 as a regulator of cell life and death. Nat Cell Biol : (2002). [Pubmed] Song X, Tao YG, Deng XY, Jin X, Tan YN, Tang M, Wu Q, Lee LM, Cao Y. Heterodimer formation between c-Jun and Jun B proteins mediated by Epstein-Barr virus encoded latent membrane protein 1. Cell Signal 16:1153-62 (2004). [Pubmed] Ameyar M, Wisniewska M, Weitzman JB. A role for AP-1 in apoptosis: the case for and against. Biochimie 85:747-52 (2003). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.