Transcription Factor
| Accessions: | ETV4 (HT-SELEX2 May2017) |
| Names: | ENSG00000175832, ETV4 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: ETS experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: ETS experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2, TF family: ETS experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2 |
| Length: | 132 |
| Pfam Domains: | 24-105 Ets-domain |
| Sequence: (in bold interface residues) | 1 EGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEV 60 61 ARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQR 120 121 PALKAEFDRPVS |
| Interface Residues: | 76, 77, 79, 80, 81, 83, 84, 98 |
| 3D-footprint Homologues: | 8smj_F, 1dux_F, 7jsa_J, 3zp5_A, 4mhg_A, 8ee9_F, 4uno_A, 2stt_A, 8smh_F, 3jtg_A, 4lg0_B, 1yo5_C, 4iri_A, 1awc_A, 4l18_B, 1bc8_C, 5d5w_B |
| Binding Motifs: | ETV4_3 gaCCGGAWGTr ETV4_6 gaCCGGAWGyr ETV4_7 stCGTAAATGCa ETV4_methyl_1 raCCGGAWGtr ETV4_methyl_2 rcmGGAAGGAaGtr ETV4_methyl_4 raCCGGAWGtr ETV4_methyl_5 acMGGAAGGAwGtr |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.