Transcription Factor

						

			
Accessions: 1j47_A (3D-footprint 20231221)

			
Names: SEX-DETERMINING REGION Y PROTEIN, SRY_HUMAN, Testis-determining factor
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q05066
Length: 85
Pfam Domains:      4-63 Domain of unknown function (DUF1898)
     5-73 HMG (high mobility group) box
Sequence: 
(in bold interface residues)		   1 MQDRVKRPINAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQK   60
  61 LQAMHREKYPNYKYRPRRKAKMLPK
Interface Residues: 7, 10, 12, 13, 16, 20, 31, 32, 33, 36, 74, 78
3D-footprint Homologues: 3u2b_C, 1o4x_B, 7m5w_A, 3f27_D, 4s2q_D, 1qrv_A, 3tmm_A, 4y60_C, 2gzk_A, 1j5n_A, 6jrp_D, 2lef_A, 1hry_A, 3tq6_B
Binding Motifs: 1j47_A ACAAAC
Binding Sites: 1j47_B
1j47_C
			
Publications: Murphy E.C, Zhurkin V.B, Louis J.M, Cornilescu G, Clore G.M. Structural basis for SRY-dependent 46-X,Y sex reversal: modulation of DNA bending by a naturally occurring point mutation. Journal of molecular biology 312:481-99 (2001). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.