Transcription Factor
| Accessions: | 1ahd_P (3D-footprint 20231221) |
| Names: | ANTP_DROSU, Homeotic protein antennapedia |
| Organisms: | Drosophila melanogaster, Drosophila subobscura |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P02833 |
| Length: | 68 |
| Pfam Domains: | 3-59 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKE 60 61 NKTKGEPG |
| Interface Residues: | 2, 3, 4, 5, 6, 7, 44, 45, 47, 48, 51, 52, 55, 56, 58, 59 |
| 3D-footprint Homologues: | 4j19_B, 3a01_E, 1fjl_B, 5zfz_A, 1ig7_A, 2h1k_B, 1puf_A, 6a8r_A, 3cmy_A, 3d1n_M, 1zq3_P, 6m3d_C, 1jgg_B, 3lnq_A, 2lkx_A, 3rkq_B, 2r5y_A, 6es3_K, 4xrs_G, 2hos_A, 1nk2_P, 7q3o_C, 1b72_A, 4cyc_A, 5flv_I, 2ld5_A, 5zjt_E, 5hod_A, 2hdd_A, 7psx_B, 5jlw_D, 2xsd_C, 7xrc_C, 1e3o_C, 1le8_A, 1au7_A, 1puf_B, 3l1p_A, 1o4x_A, 1du0_A, 8g87_X, 4qtr_D, 6x1j_A |
| Binding Motifs: | 1ahd_P AnnnCATtAGA |
| Binding Sites: | 1ahd_A 1ahd_B |
| Publications: | Billeter M., Qian Y.-Q., Otting G., Mulller M., Gehring W. J., Wutethrich K. Determination of the nuclear magnetic resonance solution structure of an Antennapedia homeodomain-DNA complex. J. Mol. Biol. 234:1084-1093 (1993). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.