Transcription Factor

Accessions: 1ahd_P (3D-footprint 20241219)
Names: ANTP_DROSU, Homeotic protein antennapedia
Organisms: Drosophila melanogaster, Drosophila subobscura
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P02833
Length: 68
Pfam Domains: 3-59 Homeobox domain
Sequence:
(in bold interface residues)
1 MRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKE 60
61 NKTKGEPG
Interface Residues: 3, 4, 6, 44, 45, 47, 48, 51, 52, 54, 55, 56, 58, 59
3D-footprint Homologues: 8ejp_B, 8pmf_A, 6m3d_C, 1zq3_P, 2lkx_A, 6es3_K, 8osb_E, 7q3o_C, 2ld5_A, 8eml_B, 2hdd_A, 9b8u_A, 4cyc_A, 8ik5_C, 7psx_B, 2hos_A, 7xrc_C, 8g87_X, 8bx1_A, 6x1j_A
Binding Motifs: 1ahd_P AnnnCATtAGA
Binding Sites: 1ahd_A
1ahd_B
Publications: Billeter M., Qian Y.-Q., Otting G., Mulller M., Gehring W. J., Wutethrich K. Determination of the nuclear magnetic resonance solution structure of an Antennapedia homeodomain-DNA complex. J. Mol. Biol. 234:1084-1093 (1993). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.