Transcription Factor

Accessions: 3fyl_B (3D-footprint 20250804), 3g6u_B (3D-footprint 20250804)
Names: GCR_RAT, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P06536
Length: 76
Pfam Domains: 3-70 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 SHMCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR 60
61 YRKCLQAGMNLEARKT
Interface Residues: 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 4hn5_B, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A
Binding Motifs: 3fyl_AB GnACAnnntGTaC
3fyl_B TGTnCG
3g6u_AB GnaCAnnnTGTnC
3g6u_B AGnACA
Binding Sites: 3fyl_C
3fyl_D
3g6u_C
3g6u_D
Publications: Meijsing S.H, Pufall M.A, So A.Y, Bates D.L, Chen L, Yamamoto K.R. DNA binding site sequence directs glucocorticoid receptor structure and activity. Science (New York, N.Y.) 324:407-10 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.