Transcription Factor
| Accessions: | 5yef_B (3D-footprint 20250804) |
| Names: | 11-zinc finger protein, CCCTC-binding factor, CTCF_HUMAN, CTCFL paralog, Transcriptional repressor CTCF |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P49711 |
| Length: | 167 |
| Pfam Domains: | 15-38 Zinc-finger double domain 29-51 C2H2-type zinc-finger domain 29-51 C2H2-type zinc finger 44-65 Zinc-finger double domain 57-80 C2H2-type zinc-finger domain 57-79 C2H2-type zinc finger 57-79 Zinc finger, C2H2 type 72-96 Zinc-finger double domain 85-108 C2H2-type zinc finger 115-138 Zinc finger, C2H2 type 115-138 C2H2-type zinc finger 146-167 Zinc finger, C2H2 type 146-167 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 PHKCPDCDMAFVGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCS 60 61 LCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHC 120 121 DTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSH |
| Interface Residues: | 13, 14, 17, 20, 21, 29, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 52, 67, 68, 69, 70, 71, 72, 73, 74, 75, 82, 95, 96, 97, 98, 99, 101, 102, 103, 106, 126, 127, 128, 129, 132, 135, 155, 156, 158, 159, 162 |
| 3D-footprint Homologues: | 5ei9_F, 7ysf_A, 5kkq_D, 8ssq_A, 7w1m_H, 8ssu_A, 1ubd_C, 2kmk_A, 7n5w_A, 1tf3_A, 7y3l_A, 5kl3_A, 6ml4_A, 1f2i_J, 6blw_A, 1tf6_A, 6u9q_A, 4x9j_A, 2gli_A, 1g2f_F, 8h9h_G, 4m9v_C, 2lt7_A, 6e94_A, 2jpa_A, 3uk3_C, 8cuc_F, 2wbs_A, 8gn3_A, 5yj3_D, 1llm_D, 6jnm_A, 7txc_E, 6a57_A, 5k5i_A, 5v3j_F, 7y3m_I, 1yuj_A, 2drp_D, 5yel_A, 5k5l_F |
| Binding Motifs: | 5yef_B CGCCCtCTGcnG |
| Binding Sites: | 5yef_E 5yef_F |
| Publications: | Yin M, Wang J, Wang M, Li X, Zhang M, Wu Q, Wang Y. Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites. Cell Res 27:1365-1377 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.