Transcription Factor

Accessions: 5yef_B (3D-footprint 20250804)
Names: 11-zinc finger protein, CCCTC-binding factor, CTCF_HUMAN, CTCFL paralog, Transcriptional repressor CTCF
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P49711
Length: 167
Pfam Domains: 15-38 Zinc-finger double domain
29-51 C2H2-type zinc-finger domain
29-51 C2H2-type zinc finger
44-65 Zinc-finger double domain
57-80 C2H2-type zinc-finger domain
57-79 C2H2-type zinc finger
57-79 Zinc finger, C2H2 type
72-96 Zinc-finger double domain
85-108 C2H2-type zinc finger
115-138 Zinc finger, C2H2 type
115-138 C2H2-type zinc finger
146-167 Zinc finger, C2H2 type
146-167 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 PHKCPDCDMAFVGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCS 60
61 LCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHC 120
121 DTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSH
Interface Residues: 13, 14, 17, 20, 21, 29, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 52, 67, 68, 69, 70, 71, 72, 73, 74, 75, 82, 95, 96, 97, 98, 99, 101, 102, 103, 106, 126, 127, 128, 129, 132, 135, 155, 156, 158, 159, 162
3D-footprint Homologues: 5ei9_F, 7ysf_A, 5kkq_D, 8ssq_A, 7w1m_H, 8ssu_A, 1ubd_C, 2kmk_A, 7n5w_A, 1tf3_A, 7y3l_A, 5kl3_A, 6ml4_A, 1f2i_J, 6blw_A, 1tf6_A, 6u9q_A, 4x9j_A, 2gli_A, 1g2f_F, 8h9h_G, 4m9v_C, 2lt7_A, 6e94_A, 2jpa_A, 3uk3_C, 8cuc_F, 2wbs_A, 8gn3_A, 5yj3_D, 1llm_D, 6jnm_A, 7txc_E, 6a57_A, 5k5i_A, 5v3j_F, 7y3m_I, 1yuj_A, 2drp_D, 5yel_A, 5k5l_F
Binding Motifs: 5yef_B CGCCCtCTGcnG
Binding Sites: 5yef_E
5yef_F
Publications: Yin M, Wang J, Wang M, Li X, Zhang M, Wu Q, Wang Y. Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites. Cell Res 27:1365-1377 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.