Transcription Factor
Accessions: | 6t78_B (3D-footprint 20231221) |
Names: | SOX11_HUMAN, Transcription factor SOX-11 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P35716 |
Length: | 74 |
Pfam Domains: | 2-70 HMG (high mobility group) box 3-60 Domain of unknown function (DUF1898) |
Sequence: (in bold interface residues) | 1 HIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRL 60 61 KHMADYPDYKYRPR |
Interface Residues: | 4, 7, 9, 10, 11, 13, 17, 28, 29, 30, 33, 71 |
3D-footprint Homologues: | 1o4x_B, 7m5w_A, 3f27_D, 4s2q_D, 1qrv_A, 3tmm_A, 4y60_C, 2gzk_A, 1j5n_A, 6jrp_D, 2lef_A, 3u2b_C, 1hry_A, 3tq6_B, 1ckt_A |
Binding Motifs: | 6t78_AB ACAATAAATTGT |
Binding Sites: | 6t78_C 6t78_D |
Publications: | Dodonova SO, Zhu F, Dienemann C, Taipale J, Cramer P. Nucleosome-bound SOX2 and SOX11 structures elucidate pioneer factor function. Nature 580:669-672 (2020). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.