Transcription Factor

						

			
Accessions: Q4H2H0 (JASPAR 2024)

			
Names: Q4H2H0_CIOIN
Organisms: Ciona intestinalis
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q4H2H0
Length: 176
Pfam Domains:      1-21 Zinc-finger double domain
     9-25 C2H2-type zinc finger
    10-29 C2H2-type zinc finger
    10-32 Zinc finger, C2H2 type
    24-47 Zinc-finger double domain
    38-60 C2H2-type zinc finger
    38-60 C2H2-type zinc finger
    38-60 Zinc finger, C2H2 type
    52-76 Zinc-finger double domain
    65-75 C2H2-type zinc finger
    66-88 Zinc finger, C2H2 type
    66-88 C2H2-type zinc finger
   81-105 Zinc-finger double domain
   94-116 Zinc finger, C2H2 type
   94-112 Zinc-finger of C2H2 type
   94-105 C2H2-type zinc finger
   94-116 C2H2-type zinc finger
  110-132 Zinc-finger double domain
  122-144 Zinc finger, C2H2 type
  122-142 Zinc-finger of C2H2 type
  122-144 C2H2-type zinc finger
  122-144 C2H2-type zinc finger
  137-159 Zinc-finger double domain
  150-172 C2H2-type zinc finger
  150-161 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 MYIHYKDKTYECKLCGKGFTQYNNLKVHHFVHNNVKPFKCDKCDKAYFRQAHLTTHQRVH   60
  61 TGEKPYKCNICEKSFTVNIGLKNHQRTHTGEKPYQCKICDKSFSTKETVRVHQVVHASEK  120
 121 PFKCNICEKSFTARATLRGHQRVHTGEKPFQCKTCMKSFRDRCNMKRHEKLHLSKS
Interface Residues: 10, 21, 22, 23, 24, 26, 27, 30, 48, 49, 50, 51, 52, 54, 55, 57, 58, 59, 61, 76, 77, 78, 79, 80, 82, 83, 86, 97, 104, 105, 106, 107, 108, 109, 110, 111, 114, 115, 132, 133, 134, 135, 136, 137, 138, 139, 140, 160, 161, 162, 163, 164, 165, 167, 168
3D-footprint Homologues: 2kmk_A, 2gli_A, 8ssq_A, 1tf6_A, 2i13_A, 8ssu_A, 2drp_D, 6wmi_A, 5yel_A, 1ubd_C, 6jnm_A, 1tf3_A, 5und_A, 5k5l_F, 5v3j_F, 4x9j_A, 1llm_D, 6blw_A, 5kkq_D, 6u9q_A, 5ei9_F, 1mey_C, 5kl3_A, 1f2i_J, 5yj3_D, 7w1m_H, 8h9h_G, 6a57_A, 2jpa_A, 8cuc_F, 7y3l_A, 7n5w_A, 3uk3_C, 6ml4_A, 2wbs_A, 5k5i_A, 7eyi_G, 2lt7_A, 8gh6_A, 7y3m_I, 6e94_A, 7ysf_A, 1g2f_F, 7txc_E, 8gn3_A, 4m9v_C
Binding Motifs: UN0481.1 gwywdaCATTgAAGTCmywycy
UN0481.2 CATTgAAGTC
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.