Transcription Factor
| Accessions: | Q4H2H0 (JASPAR 2024) |
| Names: | Q4H2H0_CIOIN |
| Organisms: | Ciona intestinalis |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q4H2H0 |
| Length: | 176 |
| Pfam Domains: | 1-21 Zinc-finger double domain 9-25 C2H2-type zinc finger 10-29 C2H2-type zinc finger 10-32 Zinc finger, C2H2 type 24-47 Zinc-finger double domain 38-60 C2H2-type zinc finger 38-60 Zinc finger, C2H2 type 38-60 C2H2-type zinc finger 52-76 Zinc-finger double domain 65-75 C2H2-type zinc finger 66-88 C2H2-type zinc finger 66-88 Zinc finger, C2H2 type 81-105 Zinc-finger double domain 94-112 Zinc-finger of C2H2 type 94-105 C2H2-type zinc finger 94-116 C2H2-type zinc finger 94-116 Zinc finger, C2H2 type 110-132 Zinc-finger double domain 122-142 Zinc-finger of C2H2 type 122-144 C2H2-type zinc finger 122-144 C2H2-type zinc finger 122-144 Zinc finger, C2H2 type 137-159 Zinc-finger double domain 150-161 C2H2-type zinc finger 150-172 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MYIHYKDKTYECKLCGKGFTQYNNLKVHHFVHNNVKPFKCDKCDKAYFRQAHLTTHQRVH 60 61 TGEKPYKCNICEKSFTVNIGLKNHQRTHTGEKPYQCKICDKSFSTKETVRVHQVVHASEK 120 121 PFKCNICEKSFTARATLRGHQRVHTGEKPFQCKTCMKSFRDRCNMKRHEKLHLSKS |
| Interface Residues: | 10, 21, 22, 23, 24, 26, 27, 30, 48, 49, 50, 51, 52, 54, 55, 57, 58, 59, 61, 76, 77, 78, 79, 80, 82, 83, 86, 97, 104, 105, 106, 107, 108, 109, 110, 111, 114, 115, 132, 133, 134, 135, 136, 137, 138, 139, 140, 160, 161, 162, 163, 164, 165, 167, 168 |
| 3D-footprint Homologues: | 2kmk_A, 2drp_D, 2gli_A, 8ssq_A, 1tf6_A, 8ssu_A, 5yel_A, 1ubd_C, 1tf3_A, 6jnm_A, 1llm_D, 5v3j_F, 7w1m_H, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 1f2i_J, 5kkq_D, 5yj3_D, 5ei9_F, 5kl3_A, 8h9h_G, 6a57_A, 2jpa_A, 8cuc_F, 7y3l_A, 7n5w_A, 3uk3_C, 6ml4_A, 2wbs_A, 5k5i_A, 7ysf_A, 2lt7_A, 6e94_A, 8gh6_A, 7y3m_I, 1g2f_F, 7txc_E, 8gn3_A, 4m9v_C |
| Binding Motifs: | UN0481.1 gwywdaCATTgAAGTCmywycy UN0481.2 CATTgAAGTC |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.