Transcription Factor

Accessions: Q4H2H0 (JASPAR 2024)
Names: Q4H2H0_CIOIN
Organisms: Ciona intestinalis
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q4H2H0
Length: 176
Pfam Domains: 1-21 Zinc-finger double domain
9-25 C2H2-type zinc finger
10-29 C2H2-type zinc finger
10-32 Zinc finger, C2H2 type
24-47 Zinc-finger double domain
38-60 C2H2-type zinc finger
38-60 Zinc finger, C2H2 type
38-60 C2H2-type zinc finger
52-76 Zinc-finger double domain
65-75 C2H2-type zinc finger
66-88 C2H2-type zinc finger
66-88 Zinc finger, C2H2 type
81-105 Zinc-finger double domain
94-112 Zinc-finger of C2H2 type
94-105 C2H2-type zinc finger
94-116 C2H2-type zinc finger
94-116 Zinc finger, C2H2 type
110-132 Zinc-finger double domain
122-142 Zinc-finger of C2H2 type
122-144 C2H2-type zinc finger
122-144 C2H2-type zinc finger
122-144 Zinc finger, C2H2 type
137-159 Zinc-finger double domain
150-161 C2H2-type zinc finger
150-172 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MYIHYKDKTYECKLCGKGFTQYNNLKVHHFVHNNVKPFKCDKCDKAYFRQAHLTTHQRVH 60
61 TGEKPYKCNICEKSFTVNIGLKNHQRTHTGEKPYQCKICDKSFSTKETVRVHQVVHASEK 120
121 PFKCNICEKSFTARATLRGHQRVHTGEKPFQCKTCMKSFRDRCNMKRHEKLHLSKS
Interface Residues: 10, 21, 22, 23, 24, 26, 27, 30, 48, 49, 50, 51, 52, 54, 55, 57, 58, 59, 61, 76, 77, 78, 79, 80, 82, 83, 86, 97, 104, 105, 106, 107, 108, 109, 110, 111, 114, 115, 132, 133, 134, 135, 136, 137, 138, 139, 140, 160, 161, 162, 163, 164, 165, 167, 168
3D-footprint Homologues: 2kmk_A, 2drp_D, 2gli_A, 8ssq_A, 1tf6_A, 8ssu_A, 5yel_A, 1ubd_C, 1tf3_A, 6jnm_A, 1llm_D, 5v3j_F, 7w1m_H, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 1f2i_J, 5kkq_D, 5yj3_D, 5ei9_F, 5kl3_A, 8h9h_G, 6a57_A, 2jpa_A, 8cuc_F, 7y3l_A, 7n5w_A, 3uk3_C, 6ml4_A, 2wbs_A, 5k5i_A, 7ysf_A, 2lt7_A, 6e94_A, 8gh6_A, 7y3m_I, 1g2f_F, 7txc_E, 8gn3_A, 4m9v_C
Binding Motifs: UN0481.1 gwywdaCATTgAAGTCmywycy
UN0481.2 CATTgAAGTC
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.