Transcription Factor
| Accessions: | pad (FlyZincFinger 1.0 ) |
| Names: | CG10309 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 112 |
| Pfam Domains: | 2-23 Zinc finger, C2H2 type 2-23 C2H2-type zinc finger 15-42 Zinc-finger double domain 29-53 Zinc finger, C2H2 type 29-53 C2H2-type zinc finger 36-53 Zinc-finger of C2H2 type 45-69 Zinc-finger double domain 59-81 Zinc finger, C2H2 type 59-81 C2H2-type zinc finger 59-79 Zinc-finger of C2H2 type 73-101 Zinc-finger double domain 90-112 C2H2-type zinc finger 90-108 Zinc-finger of C2H2 type |
| Sequence: (in bold interface residues) | 1 LICPTCKREFKKKEHLTQHVKLHAGLRPFKCSEEGCDKTFSRKEHLSRHLVSHSGQKMYT 60 61 CEVCKKPFSRKDNLNKHRRIHTQTSTETLYCCDVCNKNFATKLHYEKHREMH |
| Interface Residues: | 11, 12, 13, 14, 15, 17, 18, 20, 21, 22, 24, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 52, 69, 70, 71, 72, 73, 74, 75, 76, 77, 80, 100, 101, 102, 103, 104, 106, 107 |
| 3D-footprint Homologues: | 6jnm_A, 1tf3_A, 7n5w_A, 2gli_A, 8ssu_A, 5kl3_A, 1tf6_A, 8gn3_A, 5ei9_F, 5v3j_F, 1ubd_C, 6blw_A, 2kmk_A, 6u9q_A, 5yel_A, 5kkq_D, 8h9h_G, 7ysf_A, 6e94_A, 2lt7_A, 6a57_A, 2jpa_A, 7w1m_H, 3uk3_C, 8cuc_F, 7y3l_A, 1f2i_J, 2wbs_A, 7txc_E, 1g2f_F, 6ml4_A, 5k5i_A, 1llm_D, 2drp_D, 8ssq_A, 5yj3_D, 4x9j_A, 4m9v_C, 7y3m_I, 8gh6_A |
| Binding Motifs: | pad_SANGER_5_FBgn0038418 rrAGGGGwA pad_SOLEXA_5_FBgn0038418 mcmmmcamrvarmmarrAGGGGwAm |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.