footprintDB - a database of transcription factors with annotated cis elements (DNA motifs and sites) and binding interfaces
	

Transcription Factor

Accessions: pad (FlyZincFinger 1.0 )
Names: CG10309
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 112
Pfam Domains: 2-23 Zinc finger, C2H2 type
2-23 C2H2-type zinc finger
15-42 Zinc-finger double domain
29-53 Zinc finger, C2H2 type
29-53 C2H2-type zinc finger
36-53 Zinc-finger of C2H2 type
45-69 Zinc-finger double domain
59-81 Zinc finger, C2H2 type
59-81 C2H2-type zinc finger
59-79 Zinc-finger of C2H2 type
73-101 Zinc-finger double domain
90-112 C2H2-type zinc finger
90-108 Zinc-finger of C2H2 type
Sequence:
(in bold interface residues)
1 LICPTCKREFKKKEHLTQHVKLHAGLRPFKCSEEGCDKTFSRKEHLSRHLVSHSGQKMYT 60
61 CEVCKKPFSRKDNLNKHRRIHTQTSTETLYCCDVCNKNFATKLHYEKHREMH
Interface Residues: 11, 12, 13, 14, 15, 17, 18, 20, 21, 22, 24, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 52, 69, 70, 71, 72, 73, 74, 75, 76, 77, 80, 100, 101, 102, 103, 104, 106, 107
3D-footprint Homologues: 6jnm_A, 1tf3_A, 7n5w_A, 2gli_A, 8ssu_A, 5kl3_A, 1tf6_A, 8gn3_A, 5ei9_F, 5v3j_F, 1ubd_C, 6blw_A, 2kmk_A, 6u9q_A, 5yel_A, 5kkq_D, 8h9h_G, 7ysf_A, 6e94_A, 2lt7_A, 6a57_A, 2jpa_A, 7w1m_H, 3uk3_C, 8cuc_F, 7y3l_A, 1f2i_J, 2wbs_A, 7txc_E, 1g2f_F, 6ml4_A, 5k5i_A, 1llm_D, 2drp_D, 8ssq_A, 5yj3_D, 4x9j_A, 4m9v_C, 7y3m_I, 8gh6_A
Binding Motifs: pad_SANGER_5_FBgn0038418 rrAGGGGwA
pad_SOLEXA_5_FBgn0038418 mcmmmcamrvarmmarrAGGGGwAm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.