Transcription Factor

Accessions: Hoxd9_DBD (HumanTF 1.0)
Names: Homeobox protein Hox-4.4, Homeobox protein Hox-5.2, Homeobox protein Hox-D9, Hoxd9, HXD9_MOUSE
Organisms: Mus musculus
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: P28357
Notes: Ensembl ID: ENSMUSG00000043342; DNA-binding domain sequence; TF family: homeodomain; Clone source: Hughes lab.
Length: 83
Pfam Domains: 17-73 Homeobox domain
Sequence:
(in bold interface residues)
1 LDPNNPAANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQV 60
61 KIWFQNRRMKMKKMSKEKCPKGD
Interface Residues: 17, 18, 19, 20, 58, 59, 61, 62, 65, 66, 68, 69, 70, 73
3D-footprint Homologues: 1fjl_B, 8pmf_A, 1ig7_A, 5zfz_A, 3cmy_A, 1puf_A, 3d1n_M, 8ejp_B, 6a8r_A, 1nk2_P, 1zq3_P, 2lkx_A, 7q3o_C, 2ld5_A, 6es3_K, 1puf_B, 8osb_E, 5jlw_D, 3lnq_A, 8eml_B, 1b72_A, 4xrs_G, 3a01_E, 3rkq_B, 6m3d_C, 5flv_I, 2hdd_A, 9b8u_A, 1jgg_B, 5zjt_E, 4cyc_A, 2r5y_A, 8ik5_C, 7psx_B, 2hos_A, 7xrc_C, 1e3o_C, 1le8_A, 1au7_A, 2xsd_C, 1o4x_A, 8g87_X, 1du0_A, 8bx1_A, 5hod_A, 4qtr_D
Binding Motifs: Hoxd9_DBD_1 scmATwAAa
Hoxd9_DBD_2 gymATwAAaw
Hoxd9_DBD_3 stCrTWAAa
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.