Transcription Factor

Accessions: HEN1_MOUSE (HOCOMOCO 10)
Names: Helix-loop-helix protein 1, HEN-1, HEN1_MOUSE, Nescient helix loop helix 1, NSCL-1
Organisms: Mus musculus
Libraries: HOCOMOCO 10 1
1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]
Length: 133
Pfam Domains: 77-127 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MMLNSDTMELDLPPTHSETESGFSDCGGGPGPDGAGSGDPGVVQVRSSELGESGRKDLQH 60
61 LSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLA 120
121 ICYISYLNHVLDV
Interface Residues: 77, 80, 81, 83, 84, 85, 87, 88
3D-footprint Homologues: 7z5k_B, 8osb_B, 6od3_F, 1am9_A, 4h10_A, 8osl_P, 2ypa_B, 2ql2_A, 2ypa_A, 2ql2_D
Binding Motifs: HEN1_MOUSE.H10MO.C|M01134 kgGGkmkCAGCTGCGkCCyy
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.