Transcription Factor

Accessions: 1nvp_A (3D-footprint 20250804), 1tgh_A (3D-footprint 20250804), 5fur_A (3D-footprint 20250804), 6mzm_T (3D-footprint 20250804)
Names: TATA box binding protein, TATA sequence-binding protein, TATA-binding factor, TATA-box factor, TATA-box-binding protein, TBP_HUMAN, Transcription initiation factor TFIID TBP subunit, TATA BINDING PROTEIN (TBP)
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P20226
Length: 180
Pfam Domains: 5-87 Transcription factor TFIID (or TATA-binding protein, TBP)
93-177 Transcription factor TFIID (or TATA-binding protein, TBP)
Sequence:
(in bold interface residues)
1 SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGK 60
61 MVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQ 120
121 QFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKT 180
Interface Residues: 9, 11, 39, 40, 54, 56, 62, 64, 98, 99, 101, 130, 131, 145, 147, 153, 155
3D-footprint Homologues: 6cnb_R, 1cdw_A, 5iy6_P, 7z7n_D, 1qna_B, 5n9g_G, 1ytb_A, 5oqj_O, 1ais_A, 4wzs_D
Binding Motifs: 1nvp_AC CTTTTATAnnCC
1tgh_A gTATATATA
5fur_ACGI CTTTTATA
6mzm_ABTW TATAAAAGnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnCnnnCnGA
Binding Sites: 1nvp_E
1nvp_F
1tgh_B / 1tgh_C
5fur_E / 6mzm_V
5fur_F / 6mzm_U
Publications: Bleichenbacher M, Tan S, Richmond T.J. Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes. Journal of molecular biology 332:783-93 (2003). [Pubmed]

Juo Z.S, Chiu T.K, Leiberman P.M, Baikalov I, Berk A.J, Dickerson R.E. How proteins recognize the TATA box. Journal of molecular biology 261:239-54 (1996). [Pubmed]

Louder RK, He Y, López-Blanco JR, Fang J, Chacón P, Nogales E. Structure of promoter-bound TFIID and model of human pre-initiation complex assembly. Nature 531:604-9 (2016). [Pubmed]

Patel AB, Louder RK, Greber BJ, Grünberg S, Luo J, Fang J, Liu Y, Ranish J, Hahn S, Nogales E. Structure of human TFIID and mechanism of TBP loading onto promoter DNA. Science : (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.