Transcription Factor

						

			
Accessions: 2ypb_B (3D-footprint 20231221)

			
Names: bHLHb21, Class B basic helix-loop-helix protein 21, Immunoglobulin enhancer-binding factor E12/E47, Immunoglobulin transcription factor 1, Kappa-E2-binding factor, TCF-3, TFE2_HUMAN, Transcription factor 3, TRANSCRIPTION FACTOR E2-ALPHA, Transcription factor ITF-1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P15923
Length: 74
Pfam Domains:     12-65 Helix-loop-helix DNA-binding domain
Sequence: 
(in bold interface residues)		   1 SLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQV   60
  61 ILGLEQQVRERNLN
Interface Residues: 13, 16, 17, 19, 20, 21, 23, 24
3D-footprint Homologues: 2ypa_A, 7z5k_B, 6od3_F, 7d8t_A, 6g1l_A, 2ql2_D, 2ypa_B, 2ql2_A
Binding Motifs: 2ypb_AB GnaCAnaTG
Binding Sites: 2ypb_E
2ypb_F
			
Publications: El Omari K, Hoosdally S.J, Tuladhar K, Karia D, Hall-Ponselé E, Platonova O, Vyas P, Patient R, Porcher C, Mancini E.J. Structural basis for LMO2-driven recruitment of the SCL:E47bHLH heterodimer to hematopoietic-specific transcriptional targets. Cell reports 4:135-47 (2013). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.