Transcription Factor

Accessions: 6cro_A (3D-footprint 20241219)
Names: LAMBDA CRO REPRESSOR, RCRO_LAMBD
Organisms: Enterobacteria phage lambda, Escherichia phage lambda
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03040
Length: 60
Pfam Domains: 2-59 Cro
Sequence: EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSN
Binding Motifs: 6cro_A TATCACCnnnGGTGATA
Binding Sites: 6cro_R
6cro_U
Publications: Albright R.A, Matthews B.W. Crystal structure of lambda-Cro bound to a consensus operator at 3.0 A resolution. Journal of molecular biology 280:137-51 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.