Transcription Factor

Accessions: D19A (FlyZincFinger 1.0 )
Names: CG10269
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 120
Pfam Domains: 31-54 Zinc finger, C2H2 type
31-51 C2H2-type zinc finger
45-70 Zinc-finger double domain
60-79 C2H2-type zinc finger
75-98 Zinc-finger double domain
88-110 C2H2-type zinc finger
88-110 Zinc finger, C2H2 type
88-110 Zinc-finger double-stranded RNA-binding
88-108 Zinc-finger of C2H2 type
Sequence:
(in bold interface residues)
1 QLAGTAVNPIPSVSVPSWSPQVNFTKKEGQHICPGCGRGFNNIGNMKLHYKIIHEKVKDF 60
61 ACRFCPKRFSKAQILRHHEWIHTGEKPFECKICGKHFRQETALKKHIKTHEKPNRRHVPE 120
Interface Residues: 41, 42, 43, 44, 45, 47, 48, 50, 51, 52, 55, 70, 71, 72, 73, 74, 76, 77, 84, 85, 98, 99, 100, 101, 102, 104, 105, 109
3D-footprint Homologues: 1tf3_A, 7n5w_A, 8ssq_A, 7w1m_H, 2kmk_A, 2drp_D, 8ssu_A, 1tf6_A, 2gli_A, 1ubd_C, 7ysf_A, 6e94_A, 8h9h_G, 2lt7_A, 2jpa_A, 8cuc_F, 7y3l_A, 6u9q_A, 5v3j_F, 8gn3_A, 7y3m_I, 1yuj_A, 7txc_E
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.