Transcription Factor

						

			
Accessions: 6amk_A (3D-footprint 20231221)

			
Names: F2REK9_STRVP, Putative DNA-binding protein
Organisms: strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745, Streptomyces venezuelae
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 52
Pfam Domains:      3-51 Helix-turn-helix domain
     5-41 MerR family regulatory protein
     6-49 MerR HTH family regulatory protein
Sequence: 
(in bold interface residues)		   1 PPLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTMGGHRRYREAEVRALMAG
Interface Residues: 16, 18, 21, 22, 25, 38
3D-footprint Homologues: 6amk_B, 6ama_L, 2zhg_A, 5c8e_C, 7tec_A, 5i44_I, 2vz4_A
Binding Motifs: 6amk_A AnnnGGGTA
6amk_AB TGTCCnnnnTGCCA
Binding Sites: 6amk_R
6amk_Z
			
Publications: Schumacher MA, den Hengst CD, Bush MJ, Le TBK, Tran NT, Chandra G, Zeng W, Travis B, Brennan RG, Buttner MJ. The MerR-like protein BldC binds DNA direct repeats as cooperative multimers to regulate Streptomyces development. Nat Commun 9:1139 (2018). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.