Transcription Factor

Accessions: 1gd2_G (3D-footprint 20260701), 1gd2_H (3D-footprint 20260701)
Names: AP-1-like transcription factor, AP1_SCHPO, Caffeine resistance protein 3, TRANSCRIPTION FACTOR PAP1
Organisms: Schizosaccharomyces pombe, Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q01663
Length: 64
Pfam Domains: 5-61 bZIP transcription factor
Sequence:
(in bold interface residues)
1 QEPSSKRKAQNRAAQRAFRKRKEDHLKALETQVVTLKELHSSTTLENDQLRQKVRQLEEE 60
61 LRIL
Interface Residues: 7, 10, 11, 12, 14, 15, 18, 19, 36
3D-footprint Homologues: 1gd2_G, 5t01_B, 5vpe_D, 4n41_B
Binding Motifs: 1gd2_G GGTTACG
1gd2_GH GGTTACGTAACC
Binding Sites: 1gd2_C / 1gd2_D
Publications: Fujii Y, Shimizu T, Toda T, Yanagida M, Hakoshima T. Structural basis for the diversity of DNA recognition by bZIP transcription factors. Nature structural biology 7:889-93 (2000). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.