Transcription Factor
| Accessions: | 1gd2_G (3D-footprint 20260701), 1gd2_H (3D-footprint 20260701) |
| Names: | AP-1-like transcription factor, AP1_SCHPO, Caffeine resistance protein 3, TRANSCRIPTION FACTOR PAP1 |
| Organisms: | Schizosaccharomyces pombe, Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q01663 |
| Length: | 64 |
| Pfam Domains: | 5-61 bZIP transcription factor |
| Sequence: (in bold interface residues) | 1 QEPSSKRKAQNRAAQRAFRKRKEDHLKALETQVVTLKELHSSTTLENDQLRQKVRQLEEE 60 61 LRIL |
| Interface Residues: | 7, 10, 11, 12, 14, 15, 18, 19, 36 |
| 3D-footprint Homologues: | 1gd2_G, 5t01_B, 5vpe_D, 4n41_B |
| Binding Motifs: | 1gd2_G GGTTACG 1gd2_GH GGTTACGTAACC |
| Binding Sites: | 1gd2_C / 1gd2_D |
| Publications: | Fujii Y, Shimizu T, Toda T, Yanagida M, Hakoshima T. Structural basis for the diversity of DNA recognition by bZIP transcription factors. Nature structural biology 7:889-93 (2000). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.