Transcription Factor
| Accessions: | T061908_1.02 (CISBP 1.02) |
| Names: | T061908_1.02;, ZFA24 |
| Organisms: | PBM CONSTRUCTS |
| Libraries: | CISBP 1.02 1 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] |
| Notes: | experiment type:PBM, family:C2H2 ZF |
| Length: | 88 |
| Pfam Domains: | 4-19 Zinc-finger double domain 7-30 C2H2-type zinc finger 8-30 C2H2-type zinc finger 8-30 Zinc finger, C2H2 type 22-46 Zinc-finger double domain 35-58 C2H2-type zinc finger 36-58 C2H2-type zinc finger 36-58 Zinc finger, C2H2 type 50-74 Zinc-finger double domain 63-86 C2H2-type zinc finger 64-86 C2H2-type zinc finger 64-86 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 SRPGEKPYKCPECGKSFSRSDNLVRHQRTHTGEKPYKCPECGKSFSQSSNLVRHQRTHTG 60 61 EKPYKCPECGKSFSQRAHLERHQRTHTG |
| Interface Residues: | 8, 18, 19, 20, 21, 22, 24, 25, 33, 46, 47, 48, 49, 50, 52, 53, 54, 74, 75, 76, 77, 78, 79, 80, 81, 82, 85 |
| 3D-footprint Homologues: | 2kmk_A, 6jnm_A, 1tf3_A, 6ml4_A, 5v3j_F, 7w1m_H, 7n5w_A, 5kl3_A, 5k5i_A, 7ysf_A, 2drp_D, 8ssq_A, 1f2i_J, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 2gli_A, 8ssu_A, 1g2f_F, 5kkq_D, 1ubd_C, 5ei9_F, 2jpa_A, 1llm_D, 8h9h_G, 2lt7_A, 1tf6_A, 6e94_A, 6a57_A, 1yuj_A, 3uk3_C, 8cuc_F, 7y3l_A, 7txc_E, 5yel_A, 2wbs_A, 8gn3_A, 4m9v_C, 7y3m_I, 5yj3_D |
| Binding Motifs: | M0558_1.02 GGAGAAGa |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.