Transcription Factor

Accessions: T037063_1.02 (CISBP 1.02), T24891 (AthalianaCistrome v4_May2016)
Names: AZF1, T037063_1.02;, AT5G67450, T24891;
Organisms: Arabidopsis thaliana
Libraries: CISBP 1.02 1, AthalianaCistrome v4_May2016 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), family:C2H2
Length: 245
Pfam Domains: 97-121 C2H2-type zinc finger
163-188 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MALETLNSPTATTTARPLLRYREEMEPENLEQWAKRKRTKRQRFDHGHQNQETNKNLPSE 60
61 EEYLALCLLMLARGSAVQSPPLPPLPSRASPSDHRDYKCTVCGKSFSSYQALGGHKTSHR 120
121 KPTNTSITSGNQELSNNSHSNSGSVVINVTVNTGNGVSQSGKIHTCSICFKSFASGQALG 180
181 GHKRCHYDGGNNGNGNGSSSNSVELVAGSDVSDVDNERWSEESAIGGHRGFDLNLPADQV 240
241 SVTTS
Interface Residues: 81, 85, 97, 107, 108, 109, 110, 111, 114, 120, 128, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 143, 144, 147, 148, 151, 174, 175, 176, 177, 178, 179, 181
3D-footprint Homologues: 6e94_A, 2kmk_A, 8cuc_F, 7y3l_A, 6ml4_A, 2lt7_A, 8gn3_A, 1g2f_F, 7ysf_A, 5v3j_F, 7w1m_H, 5yel_A, 5yj3_D, 8ssq_A, 4x9j_A, 8gh6_A
Binding Motifs: M0378_1.02 gasTgwr
M0324 wgwGwsAGTGw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.