Transcription Factor

						

			
Accessions: MAFG_full (HumanTF 1.0)

			
Names: hMAF, MAFG, MAFG_HUMAN, Transcription factor MafG, V-maf musculoaponeurotic fibrosarcoma oncogene homolog G
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: O15525
Notes: Ensembl ID: ENSG00000197063; Full protein sequence; TF family: bZIP; Clone source: hORFeome
Length: 163
Pfam Domains:    23-115 bZIP Maf transcription factor
Sequence: 
(in bold interface residues)		   1 MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLK   60
  61 NRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFART  120
 121 VARSPVAPARGPLAAGLGPLVPGKVAATSVITIVKSKTDARS*
Interface Residues: 57, 61, 64, 65, 68, 69
3D-footprint Homologues: 4eot_A, 7x5e_E, 7x5e_F, 2wt7_B
Binding Motifs: MAFG_full awwwTGCTGAsTCAGCAwwww
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.