Transcription Factor
| Accessions: | CG9895 (FlyZincFinger 1.0 ) |
| Names: | CG9895 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 95 |
| Pfam Domains: | 13-37 Zinc finger, C2H2 type 13-37 C2H2-type zinc finger 29-46 Zinc-finger double domain 43-67 Zinc finger, C2H2 type 43-67 C2H2-type zinc finger 60-84 Zinc-finger double domain 73-95 C2H2-type zinc finger 73-95 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 GGYNDLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDEL 60 61 TRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH |
| Interface Residues: | 25, 26, 27, 28, 29, 31, 32, 34, 35, 38, 55, 56, 57, 58, 59, 60, 61, 62, 63, 66, 83, 84, 85, 86, 87, 88, 89, 90, 91, 94 |
| 3D-footprint Homologues: | 6jnm_A, 3uk3_C, 8cuc_F, 1tf3_A, 6ml4_A, 5v3j_F, 7n5w_A, 5ei9_F, 7w1m_H, 1mey_C, 5und_A, 2kmk_A, 8ssq_A, 2gli_A, 1g2f_F, 6blw_A, 5kkq_D, 8ssu_A, 6u9q_A, 5yel_A, 2i13_A, 7ysf_A, 1ubd_C, 6wmi_A, 8h9h_G, 7eyi_G, 2lt7_A, 7y3m_I, 1tf6_A, 6e94_A, 6a57_A, 2jpa_A, 5k5i_A, 7y3l_A, 4m9v_C, 2drp_D, 1f2i_J, 4x9j_A, 7txc_E, 1llm_D, 5kl3_A, 2wbs_A, 8gn3_A, 5yj3_D, 8gh6_A |
| Binding Motifs: | CG9895_SANGER_10_FBgn0034810 rdwGGGyGTGGy CG9895_SOLEXA_5_FBgn0034810 tGGGyGTGGyy |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.