Transcription Factor

						

			
Accessions: ZBTB14 (HT-SELEX2 May2017)

			
Names: ENSG00000198081, ZBTB14
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: BTB/POZ_Znf_C2H2  experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: BTB/POZ_Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: BTB/POZ_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4b0, TF family: BTB/POZ_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3
Length: 174
Pfam Domains:     20-41 C2H2-type zinc finger
    21-41 Zinc finger, C2H2 type
    34-58 Zinc-finger double domain
    47-67 Zinc-finger of C2H2 type
    47-69 C2H2-type zinc finger
    47-69 Zinc finger, C2H2 type
    61-84 Zinc-finger double domain
    75-95 Zinc-finger of C2H2 type
    75-97 C2H2-type zinc finger
    75-97 Zinc finger, C2H2 type
   89-114 Zinc-finger double domain
  103-123 Zinc-finger of C2H2 type
  103-125 C2H2-type zinc finger
  103-125 Zinc finger, C2H2 type
  117-141 Zinc-finger double domain
  131-154 Zinc finger, C2H2 type
  131-154 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 AASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQA   60
  61 HLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKD  120
 121 HERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQA
Interface Residues: 29, 30, 31, 32, 33, 36, 40, 47, 57, 58, 59, 60, 61, 63, 64, 65, 66, 67, 68, 70, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 113, 114, 115, 116, 117, 118, 119, 120, 141, 142, 143, 144, 145, 147, 148
3D-footprint Homologues: 5v3j_F, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 6jnm_A, 8ssq_A, 7w1m_H, 4x9j_A, 8ssu_A, 5kkq_D, 1tf6_A, 1g2f_F, 8h9h_G, 7y3m_I, 6a57_A, 2kmk_A, 5k5i_A, 1llm_D, 6ml4_A, 6blw_A, 2gli_A, 1f2i_J, 8gn3_A, 5yj3_D, 5ei9_F, 7txc_E, 4m9v_C, 7ysf_A, 6e94_A, 2jpa_A, 1ubd_C, 3uk3_C, 5k5l_F, 6u9q_A, 5yel_A, 2wbs_A, 5kl3_A, 2lt7_A, 2drp_D
Binding Motifs: ZBTB14_2 rtGCGCGTGCACGygr
ZBTB14_4 rTGCGCGTGCACGyGa
ZBTB14_methyl_1 rtGCGCGtGCACGygc
ZBTB14_methyl_3 GTGCGCGTGCACGTGA
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.