Transcription Factor

Accessions: HESX1 (HT-SELEX2 May2017), Q9UBX0 (JASPAR 2024)
Names: ENSG00000163666, HESX1, hAnf, HESX1_HUMAN, Homeobox expressed in ES cells 1, Homeobox protein ANF
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1, JASPAR 2024 2
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q9UBX0
Notes: TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 185
Pfam Domains: 109-165 Homeobox domain
Sequence:
(in bold interface residues)
1 MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCL 60
61 HVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQI 120
121 EVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFN 180
181 TNLLE
Interface Residues: 109, 110, 111, 112, 150, 151, 153, 154, 157, 158, 161, 162, 165
3D-footprint Homologues: 1ig7_A, 3d1n_M, 5zfz_A, 6fqp_B, 1puf_A, 5zjt_E, 2h1k_B, 1fjl_B, 6a8r_A, 3cmy_A, 1jgg_B, 6m3d_C, 3lnq_A, 2lkx_A, 1nk2_P, 1zq3_P, 2ld5_A, 6es3_K, 4xrs_G, 2hos_A, 7q3o_C, 4cyc_A, 2d5v_B, 5flv_I, 3l1p_A, 4j19_B, 3a01_E, 1au7_A, 5hod_A, 1puf_B, 2hdd_A, 7psx_B, 1b72_A, 5jlw_D, 3rkq_B, 2r5y_A, 2xsd_C, 7xrc_C, 1e3o_C, 1le8_A, 1o4x_A, 1du0_A, 8g87_X, 4qtr_D
Binding Motifs: MA0894.1 gyTAATTrry
HESX1_2 cyAATTrw
HESX1_methyl_1 cyAATTrh
MA0894.2 TAATTr
Publications: Brickman JM, Clements M, Tyrell R, McNay D, Woods K, Warner J, Stewart A, Beddington RS, Dattani M. Molecular effects of novel mutations in Hesx1/HESX1 associated with human pituitary disorders. Development 128:5189-99 (2001). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.