Transcription Factor
| Accessions: | 7cby_C (3D-footprint 20231221) |
| Names: | BF-1, BF-2, BF1, BF2, Brain factor 1, Brain factor 2, Forkhead box protein G1, Forkhead box protein G1A, Forkhead box protein G1B, Forkhead box protein G1C, Forkhead-related protein FKHL1, Forkhead-related protein FKHL2, Forkhead-related protein FKHL3, FOXG1_HUMAN, hBF-2, HFK1, HFK2, HFK3 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P55316 |
| Length: | 100 |
| Pfam Domains: | 5-100 Fork head domain |
| Sequence: (in bold interface residues) | 1 PKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLN 60 61 KCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRR |
| Interface Residues: | 2, 45, 48, 50, 51, 52, 54, 55, 56, 58, 59, 68, 75, 100 |
| 3D-footprint Homologues: | 7yzg_A, 7yz7_A, 7yzb_A, 3l2c_A, 7vox_H, 2hdc_A, 6ako_C, 2c6y_A, 7tdw_A, 3g73_A, 6el8_A, 7tdx_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 3qrf_G |
| Binding Motifs: | 7cby_C TAAACA |
| Binding Sites: | 7cby_A 7cby_B |
| Publications: | Dai S, Li J, Zhang H, Chen X, Guo M, Chen Z, Chen Y. Structural Basis for DNA Recognition by FOXG1 and the Characterization of Disease-causing FOXG1 Mutations. J Mol Biol 432:6146-6156 (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.